DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Db and AT2G35580

DIOPT Version :9

Sequence 1:NP_610244.2 Gene:Spn42Db / 35599 FlyBaseID:FBgn0033112 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_181101.1 Gene:AT2G35580 / 818123 AraportID:AT2G35580 Length:374 Species:Arabidopsis thaliana


Alignment Length:310 Identity:90/310 - (29%)
Similarity:145/310 - (46%) Gaps:62/310 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 LKMANGLYVMKGLQVDEQFGHILEQKFRSKPMEIDF--GSEQAASIINKWVESQTNNLIKDII-- 149
            :..||||::.|.|.|:..|..:|...:::....:||  .:::....:|.|||.|||.||.:::  
plant    92 ISAANGLWIEKTLNVEPSFKDLLLNSYKAAFNRVDFRTKADEVNREVNSWVEKQTNGLITNLLPS 156

  Fly   150 GPRVLTKDSRLCLVNGIHFKGEWSISFNEKETREEDFFGSDRPTRVRM----------MHVCENF 204
            .|:.......: ..|.:.|.|.|...|:...|::.||...| .|:||:          .||.|.|
plant   157 NPKSAPLTDHI-FANALFFNGRWDSQFDPSLTKDSDFHLLD-GTKVRVPFMTGASCRYTHVYEGF 219

  Fly   205 FFAVLPMFEATALRMNY-----SACNLAMIILLPDEKSNLTSLEKKLSDI-----SLEVVSSAMN 259
                      ..:.:.|     .:.:.:|.|.|||||..|.|:.::|:..     ..||:.|...
plant   220 ----------KVINLQYRRGREDSRSFSMQIYLPDEKDGLPSMLERLASTRGFLKDNEVLPSHSA 274

  Fly   260 LEKVDVKIPSFTAEFQQELSQVLMLMGMNRIFSGQAELGGMLQSEESLFVSQIVHKAFIEINEVG 324
            :.| ::|||.|..:|..|.|:.|...|:                  .:.:|.|:||:.||::|||
plant   275 VIK-ELKIPRFKFDFAFEASEALKGFGL------------------VVPLSMIMHKSCIEVDEVG 320

  Fly   325 TEAAAATAAVATFRSMPARQGPPKV--FHANRPFFYAIKDNTHGL-LFAG 371
            ::||||    |.||.:..|:.||:.  |.|:.||.:.:|:...|| ||.|
plant   321 SKAAAA----AAFRGIGCRRPPPEKHDFVADHPFLFIVKEYRSGLVLFLG 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DbNP_610244.2 SERPIN 12..373 CDD:238101 90/310 (29%)
AT2G35580NP_181101.1 plant_SERPIN 8..371 CDD:238998 90/310 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 172 1.000 Domainoid score I1138
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 172 1.000 Inparanoid score I1521
OMA 1 1.010 - - QHG57242
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1112
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X28
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
88.070

Return to query results.
Submit another query.