DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Db and SRP2

DIOPT Version :9

Sequence 1:NP_610244.2 Gene:Spn42Db / 35599 FlyBaseID:FBgn0033112 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_179060.1 Gene:SRP2 / 815941 AraportID:AT2G14540 Length:407 Species:Arabidopsis thaliana


Alignment Length:373 Identity:104/373 - (27%)
Similarity:168/373 - (45%) Gaps:68/373 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 NIIYSPLSIHISAAMLRMGTSEGSATAKEMD-EGLR---FGGLEAQQVAES-------FGVVLKS 82
            |.::||.||:   |:|       :.||...| :.||   ...|::....|:       ..||.|.
plant    58 NCVFSPASIN---AVL-------TVTAANTDNKTLRSFILSFLKSSSTEETNAIFHELASVVFKD 112

  Fly    83 YEQCQVLKMA--NGLYVMKGLQVDEQFGHILEQKFRSKPMEIDF--GSEQAASIINKWVESQTNN 143
            ..:....|:|  ||:::.:.|..:..:..:....|::...::||  .:|:....:|.|....||:
plant   113 GSETGGPKIAAVNGVWMEQSLSCNPDWEDLFLNFFKASFAKVDFRHKAEEVRLDVNTWASRHTND 177

  Fly   144 LIKDIIGPRVLTKDSRLCLVNGIHFKGEWSISFNEKETREEDF-FGSDRPTRVRMMHVCENFFFA 207
            |||:|:....:|..:.....|.::|||.|..:|::..||::.| ..:.:...|..|...|..|..
plant   178 LIKEILPRGSVTSLTNWIYGNALYFKGAWEKAFDKSMTRDKPFHLLNGKSVSVPFMRSYEKQFIE 242

  Fly   208 VLPMFEATALRMNY------SACNLAMIILLPDEKSNLTSLEKKLSDISLEVVSSAMNLEKVDV- 265
            ....|:  .||:.|      :....:|.:.|||:|..|.:|.::::. :...:.|.:...:||| 
plant   243 AYDGFK--VLRLPYRQGRDDTNREFSMYLYLPDKKGELDNLLERITS-NPGFLDSHIPEYRVDVG 304

  Fly   266 --KIPSFTAEFQQELSQVLMLMGMNRIFSGQAELGGMLQSEESLFVSQIVHKAFIEINEVGTEAA 328
              :||.|..||..|.|.|.                    ::..|.|| :..||.|||:|.|||||
plant   305 DFRIPKFKIEFGFEASSVF--------------------NDFELNVS-LHQKALIEIDEEGTEAA 348

  Fly   329 AATAAVATFRSM---PARQGPPKV-FHANRPFFYAIK-DNTHGLLFAG 371
            |||..|....|.   |.:    |: |.|:.||.:.|: |.|..|||||
plant   349 AATTVVVVTGSCLWEPKK----KIDFVADHPFLFLIREDKTGTLLFAG 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DbNP_610244.2 SERPIN 12..373 CDD:238101 104/373 (28%)
SRP2NP_179060.1 SERPIN 36..397 CDD:294093 104/373 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 172 1.000 Domainoid score I1138
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 172 1.000 Inparanoid score I1521
OMA 1 1.010 - - QHG57242
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1112
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.070

Return to query results.
Submit another query.