DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Db and zgc:173729

DIOPT Version :9

Sequence 1:NP_610244.2 Gene:Spn42Db / 35599 FlyBaseID:FBgn0033112 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_001103200.1 Gene:zgc:173729 / 798311 ZFINID:ZDB-GENE-071004-64 Length:439 Species:Danio rerio


Alignment Length:440 Identity:139/440 - (31%)
Similarity:210/440 - (47%) Gaps:75/440 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 EEFAQGLEQFALCLHDHLCRASAGLNIIYSPLSIHISAAMLRMGTSEGSATAKEMDEGLRFG--- 65
            |..:....||:|.|...:...:|..|:.|||:||..:.||:.:| ::|: ||.:|.:.|.|.   
Zfish     2 ESLSAANTQFSLNLFKKISGGNASGNVFYSPVSISSALAMVSLG-AKGN-TADQMFKVLGFNNPP 64

  Fly    66 --------------------GLEAQ---------------------------------QVAESFG 77
                                |:::|                                 |:..||.
Zfish    65 KPGGATPTPAQATQKPQITCGVKSQHEPQALQQPQKFELPADLKKCPAQPVPGQKAEEQIHSSFN 129

  Fly    78 VVLKSYEQ---CQVLKMANGLYVMKGLQVDEQFGHILEQKFRSKPMEIDFGSEQAAS--IINKWV 137
            ..:....:   ..||.:||.||..:..|..|:|....:..:.:...::||.::..||  .|||||
Zfish   130 KFMSELNKPGAPYVLSLANRLYGEQTYQFLEKFLSDAKTYYAAGLEKVDFKNKSEASRVNINKWV 194

  Fly   138 ESQTNNLIKDIIGPRVLTKDSRLCLVNGIHFKGEWSISFNEKETREEDFFGSDRPTR-VRMMHVC 201
            |..|...|||::....:...:||.|||.|:|||.|...|.::.||:..|..:...|: |:|||..
Zfish   195 EKNTQEKIKDLLPSGAIDAMTRLVLVNAIYFKGNWEKKFTKEATRDGQFKLNKNQTKPVKMMHQK 259

  Fly   202 ENFFFAVLPMFEATALRMNYSACNLAMIILLPDE----KSNLTSLEKKLSDISLE--VVSSAMNL 260
            ..|..|.:|...:..|.:.|:..||:|:|:|||:    .:.|..|||.|:...|.  ...|.|..
Zfish   260 ARFSLASIPEMNSQVLELPYAGKNLSMLIILPDQIEDATTGLQKLEKALTYEKLMEWTKPSMMCQ 324

  Fly   261 EKVDVKIPSFTAEFQQELSQVLMLMGMNRIFSGQ-AELGGMLQSEESLFVSQIVHKAFIEINEVG 324
            ::|.|.:|.|..|...::..:|:.|||..:|..| ..|.|| .|...|.:|:::||||:|:||.|
Zfish   325 QEVQVSLPKFKTEQTYDMKSLLVSMGMEDVFDPQKVNLTGM-SSSNDLVLSKVIHKAFVEVNEEG 388

  Fly   325 TEAAAATAAVATFRSMPARQGPPKVFHANRPFFYAIKDN-THGLLFAGHF 373
            |||||||..:||..|||.  .|||.|.|:.||.:.|:.| |:.:||.|.|
Zfish   389 TEAAAATGVIATLTSMPL--SPPKTFTADHPFIFFIRHNPTNAILFYGRF 436

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DbNP_610244.2 SERPIN 12..373 CDD:238101 137/430 (32%)
zgc:173729NP_001103200.1 SERPIN 4..439 CDD:294093 138/438 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 218 1.000 Domainoid score I2586
eggNOG 1 0.900 - - E33208_3BBFJ
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.830

Return to query results.
Submit another query.