DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Db and Serpind1

DIOPT Version :9

Sequence 1:NP_610244.2 Gene:Spn42Db / 35599 FlyBaseID:FBgn0033112 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_077358.1 Gene:Serpind1 / 79224 RGDID:619854 Length:479 Species:Rattus norvegicus


Alignment Length:372 Identity:93/372 - (25%)
Similarity:163/372 - (43%) Gaps:47/372 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 RASAGLNIIYSPLSIHISAAMLRMGTSEGSATAKEMDEGLRFGG-------------------LE 68
            :|::..||..:|:.|..:..|:.:|..  ..|.:|:...|.|..                   |.
  Rat   124 QATSSDNIFIAPVGISTAMGMISLGLR--GETHEEVHSVLHFKDFVNASSKYEVTTIHNLFRKLT 186

  Fly    69 AQQVAESFGVVLKSYEQCQVLKMANGLYVMKGLQVDEQFGHILEQKFRSKPMEIDFGSEQAASII 133
            .:....:||..|:|         .|.||:.|...:.|.|...:.:.:.::..|.||......|..
  Rat   187 HRLFRRNFGYTLQS---------VNDLYIQKQFPIREDFKAAMREFYFAEAQEADFSDPAFISKA 242

  Fly   134 NKWVESQTNNLIKDIIGPRVLTKDS--RLCLVNGIHFKGEWSISFNEKETREEDFFGSDRP-TRV 195
            |..:...|..|||:.:.    ..||  ::.::|.|:|||.|...|..:.|...:|..::|. .:|
  Rat   243 NSHILKLTKGLIKEALE----NTDSATQMMILNCIYFKGAWMNKFPVEMTHNHNFRLNEREVVKV 303

  Fly   196 RMMHVCENFFFAVLPMFEATALRMNYSACNLAMIILLPDEKSNLTSLEKKLSDISLEVVSSAMNL 260
            .||....||..|.....:...|::.|.. .::|:|::|.:.|.:.:||.:|:...:|....:|..
  Rat   304 SMMQTKGNFLAANDQELDCDILQLEYVG-GISMLIVIPRKLSGMKTLEAQLTPQVVERWQKSMTN 367

  Fly   261 EKVDVKIPSFTAEFQQELSQVLMLMGMNRIFSGQAELGGMLQSEESLFVSQIVHKAFIEINEVGT 325
            ...:|.:|.|..|....|.:||..||:.::|:....:.|:  |::.:.:....|::.|.:||.||
  Rat   368 RTREVLLPKFKLEKNYNLVEVLKSMGITKLFNKNGNMSGI--SDQRIIIDLFKHQSTITVNEEGT 430

  Fly   326 EAAAATAAVATFRSMPARQGPPKVFHANRPFFYAIKDN-THGLLFAG 371
            :|||.|.......|...|      |..:|||.:.:.:: |..|||.|
  Rat   431 QAAAVTTVGFMPLSTQVR------FTVDRPFLFLVYEHRTSCLLFMG 471

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DbNP_610244.2 SERPIN 12..373 CDD:238101 93/372 (25%)
Serpind1NP_077358.1 HCII 44..477 CDD:239002 93/372 (25%)
2 X 11 AA approximate repeats, Asp/Glu-rich (acidic) (hirudin-like) 55..79
Glycosaminoglycan-binding site. /evidence=ECO:0000250 172..192 1/19 (5%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.