DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Db and Serpine3

DIOPT Version :9

Sequence 1:NP_610244.2 Gene:Spn42Db / 35599 FlyBaseID:FBgn0033112 Length:388 Species:Drosophila melanogaster
Sequence 2:XP_006252257.2 Gene:Serpine3 / 691375 RGDID:1585042 Length:413 Species:Rattus norvegicus


Alignment Length:436 Identity:90/436 - (20%)
Similarity:173/436 - (39%) Gaps:110/436 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 AQGL----EQFALCLHDHLCRASAGLNIIYSPLSIHISAAMLRMGTSEGSATAKEMDEGLRFGGL 67
            ::||    .:|||.|:......:.|.|.:.||.|:.:|..:|:....                |.
  Rat    25 SEGLWLLKTEFALHLYQSAAAETNGTNFVISPASVSLSLEILQFAAR----------------GN 73

  Fly    68 EAQQVAESFG----------------VVLKSYEQCQVLKMANGLYVMKGLQVDEQFGHILEQKFR 116
            ...|:||:.|                :.|.:..|...:::|..|::..|..:...|   :||   
  Rat    74 TGWQLAEALGYTVQDPRVREFLHTVYITLHNSSQGIGMELACTLFMQTGTSLSPCF---VEQ--- 132

  Fly   117 SKPMEIDFGSEQAASIINKWVESQTNNLIKDIIGPRVLTKD------------------------ 157
                            :::|..|...  :.|...|...|.:                        
  Rat   133 ----------------VSRWANSSLE--LADFSEPNTTTMEASKGTTRPSTGEGPGSPLWGRAGA 179

  Fly   158 --SRLCLVNGIHFKGEWSISFNEKETREEDF-FGSDRPTRVRMMH-VCENFF--FAVLPMFEATA 216
              ::|.:|:.:.|:..|...|:....:...| .......:|..|| |.|..:  |......:...
  Rat   180 LSTQLSIVSTMTFQSSWQQRFSSVALQPLPFTCAHGLVLQVPAMHQVAEVSYGQFQDAAGHKVDV 244

  Fly   217 LRMNYSACNLAMIILLPDEKSN-LTSLEKKLSDISLEVVSSAMNLEKVDVKIPSFTAEFQQELSQ 280
            |.:.|.....:::::||.:|.. |..:|..|:...:.:.::.:...::||.:|.|..:.|.:|..
  Rat   245 LELLYLGRVASLLLVLPQDKGTPLDHIEPHLTARVIHLWTTRLKRARMDVFLPRFRIQNQFDLKS 309

  Fly   281 VLMLMGMNRIFSG-QAELGGMLQSEESLFVSQIVHKAFIEINEVGTEAAAATAAVATFRS-MPAR 343
            :|...|:..:|.. :|.|.| :...:..:||::.|||.:|::|.||::.||||.:...|| .|| 
  Rat   310 ILRSWGITDLFDPLKANLKG-ISGRDGFYVSEVTHKAKMELSEEGTKSCAATAVLLLRRSRTPA- 372

  Fly   344 QGPPKVFHANRPFFYAIKDN-------THGLLFAGHFITTKVEQSE 382
                  |.|:|||.:.::::       |||.:  .:|:..::.|.:
  Rat   373 ------FKADRPFIFLLREHNTVAVRITHGKV--ANFLNFQLGQED 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DbNP_610244.2 SERPIN 12..373 CDD:238101 86/416 (21%)
Serpine3XP_006252257.2 serpin 20..400 CDD:422956 88/424 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.110

Return to query results.
Submit another query.