DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Db and SERPINA7

DIOPT Version :9

Sequence 1:NP_610244.2 Gene:Spn42Db / 35599 FlyBaseID:FBgn0033112 Length:388 Species:Drosophila melanogaster
Sequence 2:XP_006724746.1 Gene:SERPINA7 / 6906 HGNCID:11583 Length:425 Species:Homo sapiens


Alignment Length:380 Identity:104/380 - (27%)
Similarity:176/380 - (46%) Gaps:26/380 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 FALCLHDHLCRASAGLNIIYSPLSIHISAAMLRMGTSEGSATAKEMDEGLRFGGLEAQQVAESFG 77
            ||..|:......:...||.:||:||..:..||..|..  .:|..|:.|.|.|...:...|....|
Human    49 FAFNLYRRFTVETPDKNIFFSPVSISAALVMLSFGAC--CSTQTEIVETLGFNLTDTPMVEIQHG 111

  Fly    78 ----VVLKSYEQCQV-LKMANGLYVMKGLQVDEQFGHILEQKFRSKPMEIDFGSEQAA-SIINKW 136
                :...::.:.:: |::.|.|::.|.|:...:|.:.::..:.::....||.:..|| ..||..
Human   112 FQHLICSLNFPKKELELQIGNALFIGKHLKPLAKFLNDVKTLYETEVFSTDFSNISAAKQEINSH 176

  Fly   137 VESQTNNLIKDIIGPRVLTKDSRLCLVNGIHFKGEWSISFNEKETREEDFFGSDRPTRVR--MMH 199
            ||.||...:..:|  :.|..::.:.|||.||||.:|:..|:..:|.:...|..|:.|.|:  |||
Human   177 VEMQTKGKVVGLI--QDLKPNTIMVLVNYIHFKAQWANPFDPSKTEDSSSFLIDKTTTVQVPMMH 239

  Fly   200 VCENFFFAVLPMFEATALRMNYSACNLAMIILLPDEKSNLTSLEKKLSDISLEVVSSAMNLEKVD 264
            ..|.::..|......|.|:|:||...||:.: ||.| ..:.|:|..:|..:|:..:..:....||
Human   240 QMEQYYHLVDMELNCTVLQMDYSKNALALFV-LPKE-GQMESVEAAMSSKTLKKWNRLLQKGWVD 302

  Fly   265 VKIPSFTAEFQQELSQVLMLMGMNRIFSGQAELGGM-------LQSEESLFV--SQIVHKAFIEI 320
            :.:|.|:.....:|...|:.||:...:|..|:..|:       |.:..:.||  :|..|||.:.|
Human   303 LFVPKFSISATYDLGATLLKMGIQHAYSENADFSGLTEDNGLKLSNRPAGFVLPTQAAHKAVLHI 367

  Fly   321 NEVGTEAAAATAAVATFRSMPARQGPPKVFHANRPFFYAIKD-NTHGLLFAGHFI 374
            .|.||||||...  ......|.......:...:|.|...|.: :|..:||.|..:
Human   368 GEKGTEAAAVPE--VELSDQPENTFLHPIIQIDRSFMLLILERSTRSILFLGKVV 420

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DbNP_610244.2 SERPIN 12..373 CDD:238101 104/377 (28%)
SERPINA7XP_006724746.1 alpha-1-antitrypsin_like 46..419 CDD:239011 104/377 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.