DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Db and Serpina12

DIOPT Version :9

Sequence 1:NP_610244.2 Gene:Spn42Db / 35599 FlyBaseID:FBgn0033112 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_080811.1 Gene:Serpina12 / 68054 MGIID:1915304 Length:413 Species:Mus musculus


Alignment Length:368 Identity:99/368 - (26%)
Similarity:177/368 - (48%) Gaps:19/368 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 KD-EEFAQGLEQFALCLHDHLCRASAGLNIIYSPLSIHISAAMLRMGTSEGSATAKEMDEGLRFG 65
            || .:.|:...:|...|...|...|...||..|||||..:.:||.:|..  ::|.:|:.||..|.
Mouse    43 KDARQLARHNMEFGFKLLQRLASNSPQGNIFLSPLSISTAFSMLSLGAQ--NSTLEEIREGFNFK 105

  Fly    66 GLEAQQVAESFGVVL-KSYEQCQVLKM--ANGLYVMKGLQVDEQFGHILEQKFRSKPMEIDFGS- 126
            .:....|..:|..:| |..::.:..||  .|.|::.:.|:..::|.::.:..:.:..:..:|.. 
Mouse   106 EMSNWDVHAAFHYLLHKLNQETEDTKMNLGNALFMDQKLRPQQRFLNLAKNVYDADMVLTNFQDL 170

  Fly   127 EQAASIINKWVESQTNNLIKDIIGPRVLTKDSRLCLVNGIHFKGEWSISFNEKETREEDFF-GSD 190
            |.....||:::..:|::.||:::  :.:...:.:.|.|.|:|:|.|...|:.|:|:||:|| ...
Mouse   171 ENTQKDINRYISQKTHSRIKNMV--KSIDPGTVMILTNYIYFRGRWQYEFDPKQTKEEEFFIEKG 233

  Fly   191 RPTRVRMMHVCENFFFAVLPMFEATALRMNYSACNLAMIILLPDEKSNLTSLEKKLSDISLEVVS 255
            :..:|.||.....:..|.......|.|.:.|.. |:....:||| ...|..||:.|.........
Mouse   234 KTVKVPMMFQRGLYDMAYDSQLSCTILEIPYRG-NITATFVLPD-NGKLKLLEQGLQADIFAKWK 296

  Fly   256 SAMNLEKVDVKIPSFTAEFQQELSQVLMLMGMNRIFSGQAELGGMLQSEESLFVSQIVHKAFIEI 320
            |.::...|||.:|.........:.:||..:|:::||....:| ..:.|..||.|.:.||||.:::
Mouse   297 SLLSKRVVDVWVPKLRISSTYNMKKVLSRLGISKIFEENGDL-TRISSHRSLKVGEAVHKAELKM 360

  Fly   321 NEVGTEAAAATAAVATFRSMPARQGPPKVFHANRPFFYAIKDN 363
            :|.|.|.||.:.|    :::|..  .|:....:|||...|.:|
Mouse   361 DEKGMEGAAGSGA----QTLPME--TPRHMKLDRPFLMMIYEN 397

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DbNP_610244.2 SERPIN 12..373 CDD:238101 96/357 (27%)
Serpina12NP_080811.1 alpha-1-antitrypsin_like 51..408 CDD:239011 96/360 (27%)
Reactive center loop. /evidence=ECO:0000250|UniProtKB:Q8IW75 364..382 6/23 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.