DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Db and Serpina3i

DIOPT Version :9

Sequence 1:NP_610244.2 Gene:Spn42Db / 35599 FlyBaseID:FBgn0033112 Length:388 Species:Drosophila melanogaster
Sequence 2:XP_017170641.1 Gene:Serpina3i / 628900 MGIID:2182841 Length:457 Species:Mus musculus


Alignment Length:391 Identity:112/391 - (28%)
Similarity:186/391 - (47%) Gaps:54/391 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 FALCLHDHLCRASAGLNIIYSPLSIHISAAMLRMGTSEGSATAKEMDEGLRFGGLEAQQ--VAES 75
            ||..|:..|...:...|:::||.||..:.|:|.:|..  |.|.||:.|||:|...|..:  :.:.
Mouse    79 FAFSLYRKLVLKNPDENVVFSPFSIFTALALLSLGAK--SNTLKEILEGLKFNLTETPEPDIHQG 141

  Fly    76 FGVVL----KSYEQCQVLKMANGLYVMKGLQVDEQFGHILEQKFRSKPMEIDFGSE-QAASIINK 135
            |..:|    :..:|.|: ...:.|:|.|.||:..:|.......::::....||... ||..:||.
Mouse   142 FRYLLDLLSQPGDQVQI-STGSALFVEKHLQILAEFKEKARALYQAEAFTADFLQPCQAKKLIND 205

  Fly   136 WVESQTNNLIKDIIGPRVLTKDSRLCLVNGIHFK--------------GEWSISFNEKETREEDF 186
            :|.:||...||::|..  |.|.:.:.|||.|:||              |:|.:.|:.::|....|
Mouse   206 YVSNQTQGKIKELISD--LDKSTLMVLVNYIYFKGGRGHCLGVEREELGKWKMPFDPRDTFNSKF 268

  Fly   187 F-GSDRPTRVRMMHVCENFFFAVLPMF-----EATALRMNYSACNLAMIILLPDEKSNLTSLEKK 245
            : ...|..:|.||.:.|    ...|.|     ..:.:.:.|:. |.:.:.:|||: ..:..:|..
Mouse   269 YLDEKRSVKVPMMKIEE----LTTPYFRDDELSCSVVELKYTG-NASALFILPDQ-GKMQQVETS 327

  Fly   246 LSDISLEVVSSAMNLEKV-DVKIPSFTAEFQQELSQVLMLMGMNRIFSGQAELGGMLQSEESLFV 309
            |...:|....:::...:: ::.:|.|:......|..||.::|:..:||.||:|..:..:.: |.|
Mouse   328 LHPETLRKWKNSLKPSRISELHLPKFSISNDYSLEHVLPVLGIREVFSMQADLSAITGTMD-LRV 391

  Fly   310 SQIVHKAFIEINEVGTEAAAATAAVATFR-----SMPARQGPPKVFHANRPFFYAIKD-NTHGLL 368
            ||:||||.:::.|.||||||||......|     ||        ..:..|||...|.| |||..|
Mouse   392 SQVVHKAVLDVTETGTEAAAATGVKVNLRCGKIYSM--------TIYFKRPFLIIISDINTHIAL 448

  Fly   369 F 369
            |
Mouse   449 F 449

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DbNP_610244.2 SERPIN 12..373 CDD:238101 112/391 (29%)
Serpina3iXP_017170641.1 serpinA3_A1AC 62..457 CDD:381019 112/391 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.