DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Db and LOC569077

DIOPT Version :9

Sequence 1:NP_610244.2 Gene:Spn42Db / 35599 FlyBaseID:FBgn0033112 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_001188383.1 Gene:LOC569077 / 569077 -ID:- Length:384 Species:Danio rerio


Alignment Length:377 Identity:138/377 - (36%)
Similarity:204/377 - (54%) Gaps:23/377 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 FALCLHDHLCRASAGLNIIYSPLSIHISAAMLRMGTSEGSATAKEMDEGLRFGGL-EAQQVAESF 76
            |||.|:..|..:||..||.:|||||....:|:.:| :.|. ||.||:..|....: :.....||.
Zfish    11 FALDLYQALSASSAEGNIFFSPLSISAVLSMVYLG-ARGD-TAAEMERVLSLSSVSDVHSHFESL 73

  Fly    77 GVVLKSYEQCQVLKMANGLYVMKGLQVDEQFGHILEQKFRSKPMEIDF--GSEQAASIINKWVES 139
            ...:.|.....:|::||.||..|......:......:.:.::...:||  .||.:..:||||||.
Zfish    74 ISSINSPSASYILRLANRLYGEKSFSFLPECLDSTMKLYHAELQTVDFIGASEGSRQLINKWVEK 138

  Fly   140 QTNNLIKDIIGPRVLTKDSRLCLVNGIHFKGEWSISFNEKETREEDFFGSDRPTR-VRMMHVCEN 203
            ||.|.|:|::.|.::|..:||.|||.|:|||:|:.:|..|.|||..|..:.:.:. |||||....
Zfish   139 QTENKIRDLLKPGMVTTMTRLALVNAIYFKGKWTHTFQAKYTREMAFKINQKESHPVRMMHQLNK 203

  Fly   204 FFFAVLPMFEATALRMNYSACNLAMIILLPDEKSN----LTSLEKKLSDISLEVVSSAMNLEKVD 264
            ..|..||.::...|.:.|....|:|:||||||..:    |..|||:|   :||.:....|.:|:|
Zfish   204 LPFRCLPEYKLQVLELPYIQQELSMLILLPDETKDGSDPLLKLEKEL---TLEKLLDWTNRDKMD 265

  Fly   265 ------VKIPSFTAEFQQELSQVLMLMGMNRIF-SGQAELGGMLQSEESLFVSQIVHKAFIEINE 322
                  |.:|.|..|.:..||:.|..|||:.:| ..:|:|.|| .|...||||.::||||::::|
Zfish   266 TQGAVIVHLPKFKLEIESCLSETLEKMGMSSVFQETKADLTGM-GSNGGLFVSAVIHKAFVDVSE 329

  Fly   323 VGTEAAAATAAVATFRSMPARQGPPKVFHANRPFFYAIKDN-THGLLFAGHF 373
            .|||||||| .|....|...|..|...|.|:.||.:.|:.| ::.:||.|.:
Zfish   330 EGTEAAAAT-CVYIITSYVPRPEPRYYFTADHPFMFFIRHNPSNNILFLGRY 380

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DbNP_610244.2 SERPIN 12..373 CDD:238101 138/375 (37%)
LOC569077NP_001188383.1 SERPIN 5..383 CDD:294093 138/377 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.