DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Db and si:ch211-186e20.7

DIOPT Version :9

Sequence 1:NP_610244.2 Gene:Spn42Db / 35599 FlyBaseID:FBgn0033112 Length:388 Species:Drosophila melanogaster
Sequence 2:XP_021329695.1 Gene:si:ch211-186e20.7 / 566630 ZFINID:ZDB-GENE-110407-6 Length:410 Species:Danio rerio


Alignment Length:369 Identity:104/369 - (28%)
Similarity:176/369 - (47%) Gaps:48/369 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 NIIYSPLSIHISAAMLRMGTSEGSATAKEMDEGLRFGG--LEAQQVAESFGVVLKSY-EQCQV-L 89
            ||.:||.|:.|:.:.|.:|.  |..|.:::..|:.:..  ...:::.:.|..:|:.. .:..| :
Zfish    61 NIFFSPFSVSIALSELSLGA--GGDTKQQLLSGIGYNSTTFSTEEMHQLFHSLLEDIGNRTGVDI 123

  Fly    90 KMANGLYVMKGLQVDEQFGHILEQKFRSKPMEIDFGSEQAASIINKWVESQT----NNLIKDIIG 150
            .:...||.....:...:|...:::.:.|....:||..::....||.:.:.:|    |..:.|   
Zfish   124 DVGTALYASDRFKPHSKFLEDMKEFYHSDGFTVDFRVKETVDQINNYAKKKTQGKFNQAVDD--- 185

  Fly   151 PRVLTKDSRLCLVNGIHFKGEWSISFNEKETREEDFFGSDRPT-RVRMMHVCEN---FFFAVLPM 211
               |.:|:.:.|:..|:|||:|...|..::|||..|...|:.| .|:|||..|.   |:.|.|  
Zfish   186 ---LEEDTLMFLLTYIYFKGKWDKPFKPEKTRESTFHIDDKTTVPVQMMHQYERLKVFYDAEL-- 245

  Fly   212 FEATALRMNYSACNLAMIILLPDEKSNLTSLEKKLSDISLEVVSSAMNLEK---------VDVKI 267
             ....|.::|.. :.:|.:.:||:|..    .|.:.|  ||:..|..:.||         ||:.:
Zfish   246 -STKVLCLDYKD-SFSMFLAVPDDKME----HKNIKD--LEMTVSRQHFEKWRRSAFKKTVDIYV 302

  Fly   268 PSFTAEFQQELSQVLMLMGMNRIFSGQAELGGMLQSEESLFVSQIVHKAFIEINEVGTEAAAATA 332
            |..:.:....|..:|..|||..:||.:|...|:  |||.:|||:::|||.::|:|.||.|||.|.
Zfish   303 PKLSLKTSYSLKDILKGMGMADMFSDKANFTGV--SEEKIFVSKVLHKATLDIDEQGTTAAAVTG 365

  Fly   333 AVATFRSMPAR-QGPPKVFHANRPFFYAIKDNTH-GLLFAGHFI 374
            .     ||..| ..|..:...||||...|.|.|: .:||.|..:
Zfish   366 V-----SMRVRLHNPLSILKFNRPFMVFITDQTNDNILFFGKVV 404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DbNP_610244.2 SERPIN 12..373 CDD:238101 104/366 (28%)
si:ch211-186e20.7XP_021329695.1 alpha-1-antitrypsin_like 39..403 CDD:239011 104/366 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.