DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Db and serpina10a

DIOPT Version :9

Sequence 1:NP_610244.2 Gene:Spn42Db / 35599 FlyBaseID:FBgn0033112 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_001038536.2 Gene:serpina10a / 565064 ZFINID:ZDB-GENE-041014-246 Length:391 Species:Danio rerio


Alignment Length:376 Identity:89/376 - (23%)
Similarity:177/376 - (47%) Gaps:21/376 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 EEFAQGLEQFALCLHDHLCRASAGLNIIYSPLSIHISAAMLRMGTSEGSATAKEMDEGLRFGGLE 68
            ||.|.....||..|:..:. :|:..|:..|.|...::.|.|..|.  |.||..|:.:|:....:.
Zfish    27 EELAIKNADFATRLYSKIA-SSSDDNVAVSTLGATLALATLAAGA--GGATQSELLQGIGVDSMV 88

  Fly    69 AQQVAESFGVVLKSYEQCQVLKMANGLYVMKGLQVDEQFGHILEQKFRSKPMEIDFGS-EQAASI 132
            .....|....:|:...:......|.||::.:.::.|:.|.:.::|.:.:....:::.: :||...
Zfish    89 KDGEQERIQNILQQLREDAAQIPATGLFIKQDVKADDSFSNQVKQYYNADVQNVNYANGQQAKGS 153

  Fly   133 INKWVESQTNNLIKDIIGPRVLTKDSRLCLVNGIHFKGEWSISFNEKETREEDFF-GSDRPTRVR 196
            ||.:|..:|...::|::  ..:...|...|::...|.|:|...||...|:|:.|: ......:|.
Zfish   154 INDYVRGRTGEKVRDVV--ENVDPQSMAILISAAFFTGQWLQPFNATFTQEDRFYVNKYNIVQVP 216

  Fly   197 MMHVCENFFFAVLPMFEATALRMNYSAC--NLAMIILLPDEKSNLTSLEKKLSDISLEVVSSAMN 259
            ||.....::.|..|.|:...|::   .|  .:||::|||||..:.|.:::.::........:.:.
Zfish   217 MMLRSGKYYLAYDPTFKVGILKL---PCENGIAMLVLLPDEDVDYTYVDESMTGEVFRGWVAKLK 278

  Fly   260 LEKVDVKIPSFTAEFQQELSQVLMLMGMNRIFSGQAELGGMLQSEESLFVSQIVHKAFIEINEVG 324
            ..|:::::|.|:.:....||..|..:|:..||...|.|.| :.|.|.|.:|::..|..::::|.|
Zfish   279 KTKLEIQLPRFSLKQSNSLSVSLPSLGVKEIFGNTANLTG-ISSSEGLKLSEVEQKVAVDVDESG 342

  Fly   325 TEAAAATAAVATFRSMPARQGPPKVFHANRPFFYAI-KDNTHGLLFAGHFI 374
            ...|.|:.      ::.....||::.. ||||.:.: .:.|..:|:.|..:
Zfish   343 GSLAEASG------NLFMNPLPPRLTF-NRPFIFVVYHEVTKCILYIGRVV 386

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DbNP_610244.2 SERPIN 12..373 CDD:238101 86/365 (24%)
serpina10aNP_001038536.2 Serpin 33..388 CDD:278507 86/370 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.