DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Db and SERPINB13

DIOPT Version :9

Sequence 1:NP_610244.2 Gene:Spn42Db / 35599 FlyBaseID:FBgn0033112 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_001294852.1 Gene:SERPINB13 / 5275 HGNCID:8944 Length:400 Species:Homo sapiens


Alignment Length:383 Identity:111/383 - (28%)
Similarity:183/383 - (47%) Gaps:49/383 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 NIIYSPLSIHISAAMLRMGTSEGSATAKEMD--------------------------EGLRFGGL 67
            ||.:||:.|..:..|:.:||.  .|||.:::                          ||......
Human    26 NIFFSPVGILTAIGMVLLGTR--GATASQLEEVFHSEKETKSSRIKAEEKEVVRIKAEGKEIENT 88

  Fly    68 EA-----QQVAESFGVVLKSYEQCQVLKMANGLYVMKGLQVDEQFGHILEQKFRSKPMEIDF--G 125
            ||     |:.......:...||    |.:.|.|:..|.....:::...:|:.:.:....:||  .
Human    89 EAVHQQFQKFLTEISKLTNDYE----LNITNRLFGEKTYLFLQKYLDYVEKYYHASLEPVDFVNA 149

  Fly   126 SEQAASIINKWVESQTNNLIKDIIGPRVLTKDSRLCLVNGIHFKGEWSISFNEKETREEDFFGSD 190
            ::::...||.||||:||..|||:.....::..::|.|||.::|||:|...|.::.|:||.|:.:.
Human   150 ADESRKKINSWVESKTNEKIKDLFPDGSISSSTKLVLVNMVYFKGQWDREFKKENTKEEKFWMNK 214

  Fly   191 RPTR-VRMMHVCENFFFAVLPMFEATALRMNYSACNLAMIILLPDEKSNLTSLEKKLSDISLEVV 254
            ..:: |:||....:|.|..|...:|..|.:.|...:|:|.:|||::...|..:..|:|...|...
Human   215 STSKSVQMMTQSHSFSFTFLEDLQAKILGIPYKNNDLSMFVLLPNDIDGLEKIIDKISPEKLVEW 279

  Fly   255 SSAMNLE--KVDVKIPSFTAEFQQELSQVLMLMGMNRIFS-GQAELGGMLQSEESLFVSQIVHKA 316
            :|..::|  ||::.:|.|..|...:|..||..|||...|| .:|:..|| .|...|:..:.:|.:
Human   280 TSPGHMEERKVNLHLPRFEVEDGYDLEAVLAAMGMGDAFSEHKADYSGM-SSGSGLYAQKFLHSS 343

  Fly   317 FIEINEVGTEAAAATAAVATFRSMPARQGPPKVFHANRPFFYAIKDN-THGLLFAGHF 373
            |:.:.|.||||||||....|..|.|..:.    .|.|.||.:.|:.| ::.:||.|.|
Human   344 FVAVTEEGTEAAAATGIGFTVTSAPGHEN----VHCNHPFLFFIRHNESNSILFFGRF 397

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DbNP_610244.2 SERPIN 12..373 CDD:238101 110/381 (29%)
SERPINB13NP_001294852.1 SERPIN 4..400 CDD:294093 111/383 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBFJ
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.830

Return to query results.
Submit another query.