DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Db and SERPINB9

DIOPT Version :9

Sequence 1:NP_610244.2 Gene:Spn42Db / 35599 FlyBaseID:FBgn0033112 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_004146.1 Gene:SERPINB9 / 5272 HGNCID:8955 Length:376 Species:Homo sapiens


Alignment Length:371 Identity:111/371 - (29%)
Similarity:189/371 - (50%) Gaps:18/371 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 FALCLHDHLCRASAGLNIIYSPLSIHISAAMLRMGTSEGSATAKEMDEGLRFGGLEAQQVAESFG 77
            ||:.|...||:.:...|:..||:||..:.||:.:|....:||  :|.:.|...  ..:.:..:|.
Human    11 FAIRLLKILCQDNPSHNVFCSPVSISSALAMVLLGAKGNTAT--QMAQALSLN--TEEDIHRAFQ 71

  Fly    78 VVLKSYEQC---QVLKMANGLYVMKGLQVDEQFGHILEQKFRSKPMEIDF--GSEQAASIINKWV 137
            .:|....:.   .:|:.||.|:..|..|....|.....|.:.::..|:.|  .:|::...||.||
Human    72 SLLTEVNKAGTQYLLRTANRLFGEKTCQFLSTFKESCLQFYHAELKELSFIRAAEESRKHINTWV 136

  Fly   138 ESQTNNLIKDIIGPRVLTKDSRLCLVNGIHFKGEWSISFNEKETREEDF-FGSDRPTRVRMMHVC 201
            ..:|...|::::....:..::||.|||.|:|||:|:..|:|..|||..| ...:....|:||:..
Human   137 SKKTEGKIEELLPGSSIDAETRLVLVNAIYFKGKWNEPFDETYTREMPFKINQEEQRPVQMMYQE 201

  Fly   202 ENFFFAVLPMFEATALRMNYSACNLAMIILLPDEKSNLTSLEKKLS--DISLEVVSSAMNLEKVD 264
            ..|..|.:....|..|.:.|:...|::::||||:...|:::||.|:  .::.......|...:|:
Human   202 ATFKLAHVGEVRAQLLELPYARKELSLLVLLPDDGVELSTVEKSLTFEKLTAWTKPDCMKSTEVE 266

  Fly   265 VKIPSFTAEFQQELSQVLMLMGMNRIF-SGQAELGGMLQSEESLFVSQIVHKAFIEINEVGTEAA 328
            |.:|.|..:...::..||..:|:...| .|:|:|..| .:|..|.:|:.|||:|:|:||.|||||
Human   267 VLLPKFKLQEDYDMESVLRHLGIVDAFQQGKADLSAM-SAERDLCLSKFVHKSFVEVNEEGTEAA 330

  Fly   329 AATAAVATFRSMPARQGPPKVFHANRPFFYAIKDN-THGLLFAGHF 373
            ||::........ ...||.  |.|:.||.:.|:.| .:.:||.|.|
Human   331 AASSCFVVAECC-MESGPR--FCADHPFLFFIRHNRANSILFCGRF 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DbNP_610244.2 SERPIN 12..373 CDD:238101 110/369 (30%)
SERPINB9NP_004146.1 SERPIN 4..376 CDD:320777 111/371 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBFJ
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.830

Return to query results.
Submit another query.