DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Db and SERPINB8

DIOPT Version :9

Sequence 1:NP_610244.2 Gene:Spn42Db / 35599 FlyBaseID:FBgn0033112 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_001353127.1 Gene:SERPINB8 / 5271 HGNCID:8952 Length:374 Species:Homo sapiens


Alignment Length:370 Identity:112/370 - (30%)
Similarity:185/370 - (50%) Gaps:18/370 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 FALCLHDHLCRASAGLNIIYSPLSIHISAAMLRMGTSEGSATAKEMDEGLRFGGLEAQQVAESFG 77
            ||:.|...|.......|:.:||:||..:.||:.|| ::|| ||.:|.:.|..  .:...:...|.
Human    11 FAISLFKILGEEDNSRNVFFSPMSISSALAMVFMG-AKGS-TAAQMSQALCL--YKDGDIHRGFQ 71

  Fly    78 VVLKSYEQC---QVLKMANGLYVMKGLQVDEQFGHILEQKFRSKPMEIDFG--SEQAASIINKWV 137
            .:|....:.   .:|:.||.|:..|.......|....::.::::..|:.|.  :|:....||.||
Human    72 SLLSEVNRTGTQYLLRTANRLFGEKTCDFLPDFKEYCQKFYQAELEELSFAEDTEECRKHINDWV 136

  Fly   138 ESQTNNLIKDIIGPRVLTKDSRLCLVNGIHFKGEWSISFNEKETREEDFFGSDRPTRVRMMHVCE 202
            ..:|...|.:::....:...::|.|||.|:|||:|:..|:.|.||...|..::....|:||....
Human   137 AEKTEGKISEVLDAGTVDPLTKLVLVNAIYFKGKWNEQFDRKYTRGMLFKTNEEKKTVQMMFKEA 201

  Fly   203 NFFFAVLPMFEATALRMNYSACNLAMIILLPDEKSNLTSLEKKLSDISLEVVSSAMNL--EKVDV 265
            .|............|.:.|....|:|:|||||:.::|..:||.|:....:..:::..|  .||.|
Human   202 KFKMGYADEVHTQVLELPYVEEELSMVILLPDDNTDLAVVEKALTYEKFKAWTNSEKLTKSKVQV 266

  Fly   266 KIPSFTAEFQQELSQVLMLMGMNRIF-SGQAELGGMLQSEESLFVSQIVHKAFIEINEVGTEAAA 329
            .:|....|...:|...|..:||...| ..:|:..|| .:|:::.:|::.||.|:|:||.||||||
Human   267 FLPRLKLEESYDLEPFLRRLGMIDAFDEAKADFSGM-STEKNVPLSKVAHKCFVEVNEEGTEAAA 330

  Fly   330 ATAAVATFRSMPARQGPPKVFHANRPFFYAIKDN-THGLLFAGHF 373
            |||.|...|.  :|..|.  |.|:.||.:.|:.: |:.:||.|.|
Human   331 ATAVVRNSRC--SRMEPR--FCADHPFLFFIRHHKTNCILFCGRF 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DbNP_610244.2 SERPIN 12..373 CDD:238101 111/368 (30%)
SERPINB8NP_001353127.1 SERPIN 4..374 CDD:320777 112/370 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.930

Return to query results.
Submit another query.