DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Db and SERPINE2

DIOPT Version :9

Sequence 1:NP_610244.2 Gene:Spn42Db / 35599 FlyBaseID:FBgn0033112 Length:388 Species:Drosophila melanogaster
Sequence 2:XP_005246698.1 Gene:SERPINE2 / 5270 HGNCID:8951 Length:410 Species:Homo sapiens


Alignment Length:367 Identity:107/367 - (29%)
Similarity:185/367 - (50%) Gaps:47/367 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 NIIYSPLSIHISAAMLRMGTSEGSATAKEMDEGLRFGGLEAQQVAESFGVVLKSYEQCQVLKMAN 93
            ||:.||..|.....||::|..  ..|.|::...:|:|.....::.:.....:.|.:...::.:||
Human    62 NIVISPHGIASVLGMLQLGAD--GRTKKQLAMVMRYGVNGVGKILKKINKAIVSKKNKDIVTVAN 124

  Fly    94 GLYVMKGLQVDEQFGHILEQKFRSKPMEIDFGSEQAASI---INKWVESQTNNLIKDIIGP---- 151
            .::|....:::..|....:..|:.:...::|  |..||.   ||.||:::|.::|.:::.|    
Human   125 AVFVKNASEIEVPFVTRNKDVFQCEVRNVNF--EDPASACDSINAWVKNETRDMIDNLLSPDLID 187

  Fly   152 RVLTKDSRLCLVNGIHFKGEWSISFNEKETREEDFFGSD-RPTRVRMMHVCENFFFAVLPMFEAT 215
            .|||   ||.|||.::|||.|...|..:.|::..|..:| :..:|.|:        |.|.:|...
Human   188 GVLT---RLVLVNAVYFKGLWKSRFQPENTKKRTFVAADGKSYQVPML--------AQLSVFRCG 241

  Fly   216 A-----------LRMNYSACNLAMIILLPDEKSNLTSLEKKLSDISLEVVSSAMNL---EKVDVK 266
            :           :.:.|...:::|:|.||.|.|  |.|...:..||.:.:.|.|::   ::|.|.
Human   242 STSAPNDLWYNFIELPYHGESISMLIALPTESS--TPLSAIIPHISTKTIDSWMSIMVPKRVQVI 304

  Fly   267 IPSFTAEFQQELSQVLMLMGMNRIF-SGQAELGGMLQSEESLFVSQIVHKAFIEINEVGTEAAAA 330
            :|.|||..|.:|.:.|.::|:..:| |.:|....:....|:|.||.|:.||.||::|.||:|:||
Human   305 LPKFTAVAQTDLKEPLKVLGITDMFDSSKANFAKITTGSENLHVSHILQKAKIEVSEDGTKASAA 369

  Fly   331 TAAVATFRSMPARQGPPKVFHANRPFFYAIKDN-THGLLFAG 371
            |.|:     :.||..|| .|..:|||.:.|:.| |..:||.|
Human   370 TTAI-----LIARSSPP-WFIVDRPFLFFIRHNPTGAVLFMG 405

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DbNP_610244.2 SERPIN 12..373 CDD:238101 107/367 (29%)
SERPINE2XP_005246698.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
44.030

Return to query results.
Submit another query.