DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Db and SERPINB5

DIOPT Version :9

Sequence 1:NP_610244.2 Gene:Spn42Db / 35599 FlyBaseID:FBgn0033112 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_002630.2 Gene:SERPINB5 / 5268 HGNCID:8949 Length:375 Species:Homo sapiens


Alignment Length:377 Identity:98/377 - (25%)
Similarity:177/377 - (46%) Gaps:31/377 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 FALCLHDHLCRASAGLNIIYSPLSIHISAAMLRMGTSEGSATAKEMDEGLRFGGLE-----AQQV 72
            ||:.|...||......|:::||:.:..|.::.::| ::|. ||.|:.:.|.|..::     .|.|
Human    11 FAVDLFKQLCEKEPLGNVLFSPICLSTSLSLAQVG-AKGD-TANEIGQVLHFENVKDVPFGFQTV 73

  Fly    73 AESFGVVLKSYEQCQVLKMANGLYVMKGLQVDEQFGHILEQKFRSKPMEIDFGS--EQAASIINK 135
            ......:...|.    ||:...|||.|.|.:..:|....::.:..:...:||..  |:....||.
Human    74 TSDVNKLSSFYS----LKLIKRLYVDKSLNLSTEFISSTKRPYAKELETVDFKDKLEETKGQINN 134

  Fly   136 WVESQTNNLIKDIIGPRVLTKDSRLCLVNGIHFKGEWSISFNEKETREEDFFGSDRPTR-VRMMH 199
            .::..|:...::|:....:...:::.:||..:|.|:|...|:|.||:|..|..:...|: |:||:
Human   135 SIKDLTDGHFENILADNSVNDQTKILVVNAAYFVGKWMKKFSESETKECPFRVNKTDTKPVQMMN 199

  Fly   200 VCENFFFAVLPMFEATALRMNYSACNLAMIILLP----DEKSNLTSLEKKLSDISLE--VVSSAM 258
            :...|....:.......:.:.:...:|:|.||||    ||.:.|..:||:|:..||.  ...|.|
Human   200 MEATFCMGNIDSINCKIIELPFQNKHLSMFILLPKDVEDESTGLEKIEKQLNSESLSQWTNPSTM 264

  Fly   259 NLEKVDVKIPSFTAEFQQELSQVLMLMGMNRIFS-GQAELGGMLQSEESLFVSQIVHKAFIEINE 322
            ...||.:.||.|..|...:....|..:|:..||| ..::..||.:: :.:.:|.::||..:||.|
Human   265 ANAKVKLSIPKFKVEKMIDPKACLENLGLKHIFSEDTSDFSGMSET-KGVALSNVIHKVCLEITE 328

  Fly   323 VGTEAAAATAAVATFRSMPARQGPPKVFHANRPFFYAIKDN-THGLLFAGHF 373
            .|.::.....|    |.:..:.    ..:|:.||.|.|:.| |..::|.|.|
Human   329 DGGDSIEVPGA----RILQHKD----ELNADHPFIYIIRHNKTRNIIFFGKF 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DbNP_610244.2 SERPIN 12..373 CDD:238101 97/375 (26%)
SERPINB5NP_002630.2 maspin_like 4..375 CDD:239012 98/377 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.