DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Db and SERPINA4

DIOPT Version :9

Sequence 1:NP_610244.2 Gene:Spn42Db / 35599 FlyBaseID:FBgn0033112 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_001275961.1 Gene:SERPINA4 / 5267 HGNCID:8948 Length:464 Species:Homo sapiens


Alignment Length:383 Identity:105/383 - (27%)
Similarity:179/383 - (46%) Gaps:39/383 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 FALCLHDHLCRASAGLNIIYSPLSIHISAAMLRMGTSEGSATAKEMDEGLRFG--GLEAQQVAES 75
            ||...:..:...:.|.||.:|||||..:.|||.:|..  |.:..::.|||.|.  .|....|...
Human    95 FAFRFYYLIASETPGKNIFFSPLSISAAYAMLSLGAC--SHSRSQILEGLGFNLTELSESDVHRG 157

  Fly    76 FGVVLKSYE---QCQVLKMANGLYVMKGLQVDEQFGHILEQKFRSKPMEIDF----GSEQAASII 133
            |..:|.:..   .....::.:.|::...|:...:|.:.....:.:|....:|    |:.|   :|
Human   158 FQHLLHTLNLPGHGLETRVGSALFLSHNLKFLAKFLNDTMAVYEAKLFHTNFYDTVGTIQ---LI 219

  Fly   134 NKWVESQTNNLIKDIIGPRVLTKDSRLCLVNGIHFKGEWSISFNEKETREEDFFGSDRPTRVR-- 196
            |..|:.:|...|.|::..  |.||..:.|||.|:||..|...|....|..:||: .|..|.||  
Human   220 NDHVKKETRGKIVDLVSE--LKKDVLMVLVNYIYFKALWEKPFISSRTTPKDFY-VDENTTVRVP 281

  Fly   197 -MMHVCENFFFAVLPMFEATALRMNYSACNLAMIILLPDEKSNLTSLEKKLSDISLEVVSSAMNL 260
             |:...|:.::........:.|||:|.. :..:..:||:: ..:..:|:.|:.   |::....||
Human   282 MMLQDQEHHWYLHDRYLPCSVLRMDYKG-DATVFFILPNQ-GKMREIEEVLTP---EMLMRWNNL 341

  Fly   261 -------EKVDVKIPSFTAEFQQELSQVLMLMGMNRIFSGQAELGGMLQSEESLFVSQIVHKAFI 318
                   :|:::.:|.|:......|.|:|..:|...:||..|:|.| :..::.|..|:..|||.:
Human   342 LRKRNFYKKLELHLPKFSISGSYVLDQILPRLGFTDLFSKWADLSG-ITKQQKLEASKSFHKATL 405

  Fly   319 EINEVGTEAAAATA-AVATFRSMPARQGPPKVFHANRPFFYAI-KDNTHGLLFAGHFI 374
            :::|.||||||||: |:..|.:...|.    :...||||...| ..:|..:||.|..:
Human   406 DVDEAGTEAAAATSFAIKFFSAQTNRH----ILRFNRPFLVVIFSTSTQSVLFLGKVV 459

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DbNP_610244.2 SERPIN 12..373 CDD:238101 105/380 (28%)
SERPINA4NP_001275961.1 alpha-1-antitrypsin_like 91..458 CDD:239011 105/380 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.