DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Db and SERPINA5

DIOPT Version :9

Sequence 1:NP_610244.2 Gene:Spn42Db / 35599 FlyBaseID:FBgn0033112 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_000615.3 Gene:SERPINA5 / 5104 HGNCID:8723 Length:406 Species:Homo sapiens


Alignment Length:370 Identity:114/370 - (30%)
Similarity:190/370 - (51%) Gaps:27/370 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 FALCLHDHLCRASAGLNIIYSPLSIHISAAMLRMGTSEGSATAKEMDEGLRFGGLEAQQVAE--- 74
            |...|:..|..|:...:|.:||:||.:|.|||.:|.  ||:|..::.|||   ||..|:.:|   
Human    48 FTFDLYRALASAAPSQSIFFSPVSISMSLAMLSLGA--GSSTKMQILEGL---GLNLQKSSEKEL 107

  Fly    75 --SFGVVLKSYEQCQ---VLKMANGLYVMKGLQVDEQFGHILEQKFRSKPMEIDF-GSEQAASII 133
              .|..:|:...|.:   .|.:.|.|:....:.:.:.|...::..:.:.....:| .|..|...|
Human   108 HRGFQQLLQELNQPRDGFQLSLGNALFTDLVVDLQDTFVSAMKTLYLADTFPTNFRDSAGAMKQI 172

  Fly   134 NKWVESQTNNLIKDIIGPRVLTKDSRLCLVNGIHFKGEWSISFNEKETREEDFF-GSDRPTRVRM 197
            |.:|..||...|.|::  :.|..::.:.:||.|.||.:|..|||.|.|:|:||: .|:...||.|
Human   173 NDYVAKQTKGKIVDLL--KNLDSNAVVIMVNYIFFKAKWETSFNHKGTQEQDFYVTSETVVRVPM 235

  Fly   198 MHVCENFFFAVLPMFEATALRMNYSACNLAMIILLPDEKSNLTSLEKKLSDISLEVVSSAMNLEK 262
            |...:.:.:.:........:.:.|.. |...:.:||.| ..:..:|..||:.:|..........:
Human   236 MSREDQYHYLLDRNLSCRVVGVPYQG-NATALFILPSE-GKMQQVENGLSEKTLRKWLKMFKKRQ 298

  Fly   263 VDVKIPSFTAEFQQELSQVLMLMGMNRIFSGQAELGGMLQSEESLFVSQIVHKAFIEINEVGTEA 327
            :::.:|.|:.|...:|.:||..:|::.:|:..|:|.| :.:..::.||::||||.:|::|.||.|
Human   299 LELYLPKFSIEGSYQLEKVLPSLGISNVFTSHADLSG-ISNHSNIQVSEMVHKAVVEVDESGTRA 362

  Fly   328 AAATAAVATFRSMPARQGPPK-VFHANRPFFYAIKDNTHGLLFAG 371
            ||||..:.||||  ||....: ||  ||||...|.||  .:||.|
Human   363 AAATGTIFTFRS--ARLNSQRLVF--NRPFLMFIVDN--NILFLG 401

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DbNP_610244.2 SERPIN 12..373 CDD:238101 114/370 (31%)
SERPINA5NP_000615.3 alpha-1-antitrypsin_like 44..403 CDD:239011 114/370 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.