DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Db and SERPINE1

DIOPT Version :9

Sequence 1:NP_610244.2 Gene:Spn42Db / 35599 FlyBaseID:FBgn0033112 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_001373389.1 Gene:SERPINE1 / 5054 HGNCID:8583 Length:492 Species:Homo sapiens


Alignment Length:394 Identity:104/394 - (26%)
Similarity:177/394 - (44%) Gaps:70/394 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 FALCLHDHLCRASAGLNIIYSPLSIHISAAMLRMGTSEGSATAKEMDEGLRFGGLEAQQVAESFG 77
            |.:.:...:.:||...|:::||..:....|||::.|                ||...||:..:.|
Human    38 FGVRVFQQVAQASKDRNVVFSPYGVASVLAMLQLTT----------------GGETQQQIQAAMG 86

  Fly    78 VVLKSYEQCQVLK----------------MANGLYVMKGLQVDEQFGHILEQKFRSKPMEIDFGS 126
            ..:........|:                ..:.::|.:.|::.:.|.....:.|||...::||..
Human    87 FKIDDKGMAPALRHLYKELMGPWNKDEISTTDAIFVQRDLKLVQGFMPHFFRLFRSTVKQVDFSE 151

  Fly   127 -EQAASIINKWVESQTNNLIKDIIGPRVLTKDSRLCLVNGIHFKGEWSISFNEKETREEDFFGSD 190
             |:|..|||.||::.|..:|.:::|...:.:.:||.|||.::|.|:|...|.:..|....|..||
Human   152 VERARFIINDWVKTHTKGMISNLLGKGAVDQLTRLVLVNALYFNGQWKTPFPDSSTHRRLFHKSD 216

  Fly   191 RPT-RVRMMHVCENFFFAVLPMFEATA--------LRMNYSACNLAMIILLPDEK----SNLTSL 242
            ..| .|.||.....|.:.     |.|.        |.:.|....|:|.|..|.||    |.||::
Human   217 GSTVSVPMMAQTNKFNYT-----EFTTPDGHYYDILELPYHGDTLSMFIAAPYEKEVPLSALTNI 276

  Fly   243 EKKLSDISLEVVS----SAMNLEKVDVKIPSFTAEFQQELSQVLMLMGMNRIF-SGQAELGGMLQ 302
                  :|.:::|    :...|.::.| :|.|:.|.:.:|.:.|..:||..:| ..||:... |.
Human   277 ------LSAQLISHWKGNMTRLPRLLV-LPKFSLETEVDLRKPLENLGMTDMFRQFQADFTS-LS 333

  Fly   303 SEESLFVSQIVHKAFIEINEVGTEAAAATAAVATFRSMPARQGPPKVFHANRPFFYAIKDNTHGL 367
            .:|.|.|:|.:.|..||:||.||.|:::||.:.:     ||..|.::. .:|||.:.::.|..|.
Human   334 DQEPLHVAQALQKVKIEVNESGTVASSSTAVIVS-----ARMAPEEII-MDRPFLFVVRHNPTGP 392

  Fly   368 LFAG 371
            |..|
Human   393 LQDG 396

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DbNP_610244.2 SERPIN 12..373 CDD:238101 104/394 (26%)
SERPINE1NP_001373389.1 serpinE1_PAI-1 29..393 CDD:381007 102/389 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.