DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Db and Serpinb3a

DIOPT Version :9

Sequence 1:NP_610244.2 Gene:Spn42Db / 35599 FlyBaseID:FBgn0033112 Length:388 Species:Drosophila melanogaster
Sequence 2:XP_006249702.1 Gene:Serpinb3a / 498209 RGDID:1562868 Length:387 Species:Rattus norvegicus


Alignment Length:390 Identity:130/390 - (33%)
Similarity:202/390 - (51%) Gaps:35/390 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 FAQGLEQFALCLHDHLCRASAGLNIIYSPLSIHISAAMLRMGTSEGSATAKEMDEGLRFGGL--- 67
            ||:...||.|.|:..| |.|.. ||.||||||..:.|||::| ::|: |.|::::.::|...   
  Rat     4 FAKATTQFTLELYRQL-RDSED-NIFYSPLSIMTALAMLQLG-AKGN-TEKQIEKVIQFHETTKK 64

  Fly    68 ---------EAQQVAESFGVV---LKSYEQCQVLKMANGLYVMKGLQVDEQFGHILEQKFRSKPM 120
                     :.:.|.|.|..:   |........|..||.:|..|.....:.|...:::.:::...
  Rat    65 TTEKSADCHDEESVHEQFQKLMTQLNKSNDAYDLNSANSIYGAKHFPFLQTFLEDIKEYYQANVE 129

  Fly   121 EIDF--GSEQAASIINKWVESQTNNLIKDIIGPRVLTKDSRLCLVNGIHFKGEWSISFNEKETRE 183
            .:||  .:|::...||.|||:|||..|||:.....|...:.|.|||.::|||:|:..|:||.|.|
  Rat   130 SLDFAHAAEESEKKINSWVENQTNGKIKDLFPKGSLNSSTILVLVNAVYFKGQWNHKFDEKHTEE 194

  Fly   184 EDFF---GSDRPTRVRMMHVCENFFFAVLPMFEATALRMNYSACNLAMIILLPDEKSNLTSLEKK 245
            :.|:   .:.:|  |:||.....|.|..|...:|..:.:.|....|:|.||||.|...|..||::
  Rat   195 DKFWLNKNTSKP--VQMMRQKNEFNFIFLEDVQAKMVEIPYKGKELSMFILLPMEIDGLKKLEEQ 257

  Fly   246 LSDISLEVVSSAMNLEKVD--VKIPSFTAEFQQELSQVLMLMGMNRIF-SGQAELGGMLQSEESL 307
            |:...|...:.|.|:..:|  :.:|.|..|.:.:|...|..|||...| |.:|:..|| .|.:.|
  Rat   258 LTADKLLEWTRAENMNMIDLYLSLPRFKVEEKYDLPGPLQHMGMVDAFDSKKADFSGM-SSTQGL 321

  Fly   308 FVSQIVHKAFIEINEVGTEAAAATAAVATFRSMPARQGPPKVFHANRPFFYAIKDN-THGLLFAG 371
            .||:::||:|:|:||.||||||||....:..|....:.    |:.:.||.:.||.| |:.:||.|
  Rat   322 MVSKVLHKSFVEVNEEGTEAAAATGVEVSLTSAQITED----FNCDHPFLFLIKHNATNSILFFG 382

  Fly   372  371
              Rat   383  382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DbNP_610244.2 SERPIN 12..373 CDD:238101 128/384 (33%)
Serpinb3aXP_006249702.1 SERPIN 5..387 CDD:294093 129/389 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBFJ
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X28
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.830

Return to query results.
Submit another query.