DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Db and Spn42Dd

DIOPT Version :9

Sequence 1:NP_610244.2 Gene:Spn42Db / 35599 FlyBaseID:FBgn0033112 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_001163067.1 Gene:Spn42Dd / 49808 FlyBaseID:FBgn0028988 Length:372 Species:Drosophila melanogaster


Alignment Length:365 Identity:116/365 - (31%)
Similarity:194/365 - (53%) Gaps:20/365 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 LHDHLCRASAGLNIIYSPLSIHISAAMLRMGTSEGSATAKEMDEGLRFGGLEAQQVAESFGVV-- 79
            ::..|.::....|::.||:||....:|:.|| :||| ||||:...|.....:.:.||..:|.:  
  Fly    21 IYQLLSKSHTNQNLVVSPVSIETILSMVFMG-AEGS-TAKELQSALGLPSEDKEAVAARYGALLN 83

  Fly    80 -LKSYEQCQVLKMANGLYVMKGLQVDEQFGHILEQKFRSKPMEIDF-GSEQAASIINKWVESQTN 142
             |:..|:..:||:||.:||.....:::.:...:.:.|:|:...|.. ....||..||:||..||:
  Fly    84 DLQGQEEGPILKLANRIYVNDQYSLNQNYNLAVREPFKSEAESISLTNGPVAAERINQWVLDQTS 148

  Fly   143 NLIKDIIGPRVLTKDSRLCLVNGIHFKGEWSISFNEKETREEDF-FGSDRPTRVRMMHVCENFFF 206
            ..||.:|.|..:|.|.:..|||.|:|||:|...|:..:||...| ..:::...|:||.....|..
  Fly   149 GKIKGMIDPGSMTSDVKALLVNAIYFKGQWESKFDPAKTRASTFQVTANKSVPVQMMAQMGTFRA 213

  Fly   207 AVLPMFEATALRMNYSACNLAMIILLPDEKSNLTSLEKKLSDISLEVVSSAMNLEKVDVKIPSFT 271
            ......:|..:.:.|...||:|.|.||.|...|::||:|:...:..:|:     ::|.:|:|.|.
  Fly   214 NYFRDLDAQVIELPYLNSNLSMTIFLPREVEGLSALEEKIVGFARPLVA-----KEVYLKLPKFK 273

  Fly   272 AEFQQELSQVLMLMGMNRIFSGQAELGGMLQSEESLFVSQIVHKAFIEINEVGTEAAAATAAVAT 336
            .||:.||.:.|..:|:..:|:.:::|.|:...:....|||:.||||:|:||.|.|||.||:...|
  Fly   274 IEFRDELKETLEKLGIRELFTDKSDLSGLFADKSGGKVSQVSHKAFLEVNEEGAEAAGATSVAVT 338

  Fly   337 FRSMPARQGPPKVFHANRPFFYAIKD-NTHGLLFAGHFIT 375
            .|:     |......|:.||.:.|:| ||  :.|.|..::
  Fly   339 NRA-----GFSTFLMADHPFAFVIRDANT--IYFQGRVVS 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DbNP_610244.2 SERPIN 12..373 CDD:238101 116/361 (32%)
Spn42DdNP_001163067.1 SERPIN 16..369 CDD:238101 116/361 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446388
Domainoid 1 1.000 172 1.000 Domainoid score I1138
eggNOG 1 0.900 - - E33208_3BBFJ
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 172 1.000 Inparanoid score I1521
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D140751at6656
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 1 1.000 - - mtm1112
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
109.900

Return to query results.
Submit another query.