DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Db and Spn27A

DIOPT Version :9

Sequence 1:NP_610244.2 Gene:Spn42Db / 35599 FlyBaseID:FBgn0033112 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_001260143.1 Gene:Spn27A / 45815 FlyBaseID:FBgn0028990 Length:447 Species:Drosophila melanogaster


Alignment Length:384 Identity:110/384 - (28%)
Similarity:178/384 - (46%) Gaps:34/384 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 HD----HLCRA-----SAGLNIIYSPLSIHISAAMLRMGTSEGSATAKEM---DEGLRFGGLEAQ 70
            ||    ||.:.     :|..|:|.||.|:.:..|:|......|:.|..|:   ...:|    ...
  Fly    73 HDPFSWHLLKTVLQNETADKNVIISPFSVKLVLALLAEAAGAGTQTQVELANTQTDIR----SQN 133

  Fly    71 QVAESFGVVLKSYEQ----CQVLKMANGLYVMKGLQVDEQFGHILEQKFRSKPMEIDF-GSEQAA 130
            .|.|.:...|.|:::    .:.|.:...|:....::..::|...|:..:.|:...:|| ..|.||
  Fly   134 NVREFYRKTLNSFKKENQLHETLSVRTKLFTDSFIETQQKFTATLKHFYDSEVEALDFTNPEAAA 198

  Fly   131 SIINKWVESQTNNLIKDIIGPRVLTKDSRLCLVNGIHFKGEWSISFNEKETREEDFFGS-DRPTR 194
            ..||.|..:.|...::.::.|..: :.|.:.|.|.|:|.|.|...|  ..|.:..||.| |..:|
  Fly   199 DAINAWAANITQGRLQQLVAPDNV-RSSVMLLTNLIYFNGLWRRQF--ATTFQGSFFRSKDDQSR 260

  Fly   195 VRMMHVCENFFFAVLPMFEATALRMNYSACNLAMIILLPDEKSNLTSLEKKLSDISLEVVSSAMN 259
            ...|...:.|::......:|..||:.|...| ::.:|||...:.:..|.|.|.:..|:....||.
  Fly   261 AEFMEQTDYFYYTTSEKLKAQILRLPYKGKN-SLFVLLPYALNGIHDLVKNLENDELKSAQWAME 324

  Fly   260 LEKVDVKIPSFTAEFQQELSQVLMLMGMNRIFSGQAELGGMLQSEE---SLFVSQIVHKAFIEIN 321
            ..||.|.:|.|..::||.|.:.|..:|:..||...|.|.|:.:..:   .:.||.|:.||.|.:|
  Fly   325 EVKVKVTLPKFHFDYQQNLKETLRSLGVREIFEDSASLPGLTRGADVAGKVKVSNILQKAGINVN 389

  Fly   322 EVGTEAAAATAAVATFRSMPARQGPPKVFHANRPF-FYAIKDNTHGLLFAG--HFITTK 377
            |.||||.|||  |....:........:.|:.|||| |:..:::|..:||||  |..||:
  Fly   390 EKGTEAYAAT--VVEIENKFGGSTAIEEFNVNRPFVFFIEEESTGNILFAGKVHSPTTQ 446

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DbNP_610244.2 SERPIN 12..373 CDD:238101 107/378 (28%)
Spn27ANP_001260143.1 SERPIN 72..440 CDD:238101 107/376 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBFJ
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D140751at6656
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.