DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Db and serpinf1

DIOPT Version :9

Sequence 1:NP_610244.2 Gene:Spn42Db / 35599 FlyBaseID:FBgn0033112 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_001004539.1 Gene:serpinf1 / 447800 ZFINID:ZDB-GENE-040912-2 Length:406 Species:Danio rerio


Alignment Length:391 Identity:91/391 - (23%)
Similarity:171/391 - (43%) Gaps:59/391 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 EFAQGLEQFALCLHDHLCRASAGLNIIYSPLSIHISAAMLRMGTSEGSATAKEMDEGLRFGGLEA 69
            :.|.....|...|...|.......::..||:||..:...|.||.||  ...|::...||:..|:.
Zfish    43 KLAAATSDFGYNLFRQLASRDTKASVFLSPMSISAAFTQLSMGASE--RAEKQIYRALRYHTLQD 105

  Fly    70 QQVAESFGVVLKSYE-QCQVLKMANGLYVMKGLQVDEQFGHILEQKFRSKPMEIDFGSEQAASII 133
            .|:.::...:|.|.. ..:..|.|..:.:.:.|::..::.:.:|:::..:| :|..|..:....:
Zfish   106 SQLHDTLRDLLSSLRASAKGFKSAERILLARKLRLRLEYLNSVEKQYGERP-QILAGGARDLKTV 169

  Fly   134 NKWVESQTNNLIKDIIGPRVLTKDSRLCLVNGIHFKGEWSISF---NEKETREEDFFGSDRPTRV 195
            |.|.:.||...:..:: |..|.:::.|..|...:|||:|...|   |:.||...|   ...|   
Zfish   170 NDWFKQQTGGKVDQVV-PSPLPRNTALLPVGSAYFKGKWITRFGKPNKMETFRRD---GQAP--- 227

  Fly   196 RMMHVCENFFFAVLPMFEATALRMNYS---------ACNLA---------MIILLPDE-KSNLTS 241
                       ||:||.|    :.||.         .|.:|         |...|||| ..|||.
Zfish   228 -----------AVIPMME----QENYPVKMGIDSDLGCTIAQVPMEDGVSMYFFLPDEVTQNLTL 277

  Fly   242 LEKKLSDISLEVVSSAMNLEKVDVKIPSFTAEFQQELSQVLMLMGMNRIFSGQAELGGMLQSEES 306
            :|:.|:...::.:|::::..||.:.:|.....::..|...|..:|::. :..:.:|..:  :.:.
Zfish   278 IEEALTAEFVQDLSNSLHTVKVLLTLPVIKLSYKTNLLPSLSDLGLSE-WLAETDLTKI--TSQP 339

  Fly   307 LFVSQIVHKAFIEINEVGTEAAAATAAVATFRSMPARQGPPKVFHANRPFFYAIKDNTHG-LLFA 370
            :.::.:.||..:|....|.|.|:.|.: ||.:|:...      :..:|||.:.::|...| |||.
Zfish   340 VKLNAVHHKVVLETAPEGAEYASTTPS-ATGQSLGLS------YRVDRPFLFLVRDEPSGALLFI 397

  Fly   371 G 371
            |
Zfish   398 G 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DbNP_610244.2 SERPIN 12..373 CDD:238101 90/384 (23%)
serpinf1NP_001004539.1 SERPIN 30..403 CDD:294093 91/391 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.