DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Db and Spn100A

DIOPT Version :9

Sequence 1:NP_610244.2 Gene:Spn42Db / 35599 FlyBaseID:FBgn0033112 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_651818.1 Gene:Spn100A / 43642 FlyBaseID:FBgn0039795 Length:649 Species:Drosophila melanogaster


Alignment Length:270 Identity:67/270 - (24%)
Similarity:121/270 - (44%) Gaps:30/270 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   141 TNNLIKDIIGPRVLTKDSRLCLVNGIHFKGEWSISFNEKETREEDFF--GSDRPTRVRMMHVCEN 203
            |:.|..:.|..|.....|::.|.||::::|.|:..|.:.....::||  .::...:..|||....
  Fly   381 TSALSANSITGRSAGSKSKMLLFNGLYYRGSWANPFYQLRDGSDEFFFMTNEDAVKAPMMHARGK 445

  Fly   204 FFFAVLPMFEATALRMNYSACNLAMIILLPDEKSNLTSLEKKLSDISLEVVSSAMNLEKVDVKIP 268
            |..|.||..:|..|.:.|.....|:.|:||||...|:.:..:|......:......::::.:.:|
  Fly   446 FQVADLPQVKARVLSLPYETSRYALCIVLPDETEGLSDVISQLQTSDFLLAKKQFQMKELHISMP 510

  Fly   269 SFTAEFQQELSQVLMLMGMNRIFS-GQAELGGMLQSEESLFVSQIVHKAFIEINEVGTEAAAATA 332
            .|..|.......:|..||:.::|| .:|:| .:|..:..:.|.:||....:.::|.|:.|.:.:|
  Fly   511 KFQVEETSRSEAMLKQMGLKKVFSRTEAQL-SLLSEDPDVHVDEIVQFVNVRVDEGGSSANSLSA 574

  Fly   333 AVATFRS-------MPARQGPPKV-----FHANRPFFYAIKD------NTHGLLFAGHF------ 373
            |....|:       :|..:..|::     |..||||.|.|.|      ...|.::...|      
  Fly   575 ATMQARTPSVESTVLPVPEPEPELPGVERFEVNRPFAYFIVDCQEQFVLASGKIYTPEFKEDLPS 639

  Fly   374 --ITTKVEQS 381
              |..::|||
  Fly   640 VSIEVELEQS 649

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DbNP_610244.2 SERPIN 12..373 CDD:238101 62/252 (25%)
Spn100ANP_651818.1 SERPIN 41..>148 CDD:294093
SERPIN <380..628 CDD:294093 62/247 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.