DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Db and Serpinb6e

DIOPT Version :9

Sequence 1:NP_610244.2 Gene:Spn42Db / 35599 FlyBaseID:FBgn0033112 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_001039000.2 Gene:Serpinb6e / 435350 MGIID:2667778 Length:429 Species:Mus musculus


Alignment Length:359 Identity:110/359 - (30%)
Similarity:182/359 - (50%) Gaps:24/359 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 NIIYSPLSIHISAAMLRMGTSEGSATAKEMDEGLRF-----GGLEAQQVAESFGVVLKSYEQCQV 88
            |:.:|..|:..|.|::.||.:  ..||.::.:.|..     ||.:.||..:|....:...:...:
Mouse    78 NVFFSSSSMFSSLALILMGAN--GTTASQISQVLSLDKCSNGGADVQQGFQSLLTEVNKTDTGHM 140

  Fly    89 LKMANGLYVMKGLQVDEQFGHILEQKFRSKPMEIDFGS--EQAASIINKWVESQTNNLIKDIIGP 151
            |:.||.::......:.|.|.....:.:|.:..::||..  ||....||.||..:|.::|::::..
Mouse   141 LRRANKIFSDNNFDIMESFKESCYKLYRVEIEKLDFKGTPEQCRQHINAWVAKKTKDVIRELLSL 205

  Fly   152 RVLTKDSRLCLVNGIHFKGEWSISFNEKETREEDF-FGSDRPTRVRMMHVCENFFFAVLPMFEAT 215
            ..:..::||.|||..:|||:|...||:::|||..| ...:....|:||.....|..........|
Mouse   206 YTVNSNTRLILVNATYFKGKWEKQFNKEDTREMPFKVSKNEKKTVQMMSKKSTFKTYYAEEISTT 270

  Fly   216 ALRMNYSACNLAMIILLPDEKSNLTSLEKKLSDISL----EVVSSAMNLEKVDVKIPSFTAEFQQ 276
            .:.:.|:...|:|||:||||:..|:.:|.::|...|    .:|.  |..|:|.|.:|.|..|...
Mouse   271 IVFLPYTDKELSMIIMLPDEQVELSMVENQISYKKLIQWTRLVK--MEEEEVQVFLPRFKLEATY 333

  Fly   277 ELSQVLMLMGMNRIF-SGQAELGGMLQSEESLFVSQIVHKAFIEINEVGTEAAAATAAVATFRSM 340
            ::..||..:||...| ..:|:..| :.|::.||:|.:|||:|:|:||.|||||.||..|..  ..
Mouse   334 DMKDVLCKLGMTDAFEESRADFSG-ISSKKGLFLSNVVHKSFVEVNEEGTEAAVATEIVTV--GS 395

  Fly   341 PARQGPPKVFHANRPFFYAIK-DNTHGLLFAGHF 373
            |..|   :...|:|||.:.|: |.:..:||.|.|
Mouse   396 PLTQ---RCLIADRPFLFLIQGDKSKEILFLGRF 426

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DbNP_610244.2 SERPIN 12..373 CDD:238101 109/357 (31%)
Serpinb6eNP_001039000.2 serpin 53..429 CDD:393296 110/359 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBFJ
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.830

Return to query results.
Submit another query.