DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Db and Spn85F

DIOPT Version :9

Sequence 1:NP_610244.2 Gene:Spn42Db / 35599 FlyBaseID:FBgn0033112 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_649965.2 Gene:Spn85F / 41221 FlyBaseID:FBgn0037772 Length:640 Species:Drosophila melanogaster


Alignment Length:206 Identity:42/206 - (20%)
Similarity:76/206 - (36%) Gaps:25/206 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   167 HFKG---EWSISFNEKETREEDFFGSDRPTRVRMMHVCENFFFAVL--PMFE---ATALRMNYSA 223
            |:.|   |...::|........:.|:.     :::|.....:.|||  ..||   .:.|.:....
  Fly   429 HYIGEAAEGKSNYNTDVISHVFYLGNQ-----QVVHTTFKVYNAVLYYKYFEHLKMSVLELELDT 488

  Fly   224 CNLAMIILLPDEKSNLTSLEKKLS-DISLEVVSSAMNLEKVDVKIPSFTAEFQQELSQVLMLMGM 287
            ....::|||||..:::.:....|. ..:|.::...:....|...||.|.......|:..|..||:
  Fly   489 PEYNLMILLPDYHTDIVAAAASLKLGPTLRLMRKQLKPRWVQAIIPDFKLHGTMFLTNDLQNMGI 553

  Fly   288 NRIFS-GQAELGGMLQSEESLFVSQIVHKAFIEINEVGTEAAAATAAVATFRSMPARQGPPKVFH 351
            ..:|. .:|:...|.: |:.::|..|         |...:....|..:...:.....|..|....
  Fly   554 CDVFEPNRADFRPMTE-EKGVYVRHI---------EQSIDVTIRTHPINQLKRNYGAQSKPIQIS 608

  Fly   352 ANRPFFYAIKD 362
            .|.||.:.|.|
  Fly   609 VNHPFLFFIVD 619

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DbNP_610244.2 SERPIN 12..373 CDD:238101 42/206 (20%)
Spn85FNP_649965.2 SERPIN 88..>204 CDD:294093
SERPIN <450..634 CDD:294093 38/185 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11461
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.