DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Db and Spn77Ba

DIOPT Version :9

Sequence 1:NP_610244.2 Gene:Spn42Db / 35599 FlyBaseID:FBgn0033112 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_001287128.1 Gene:Spn77Ba / 40234 FlyBaseID:FBgn0262057 Length:450 Species:Drosophila melanogaster


Alignment Length:392 Identity:114/392 - (29%)
Similarity:178/392 - (45%) Gaps:49/392 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 AQGLEQFALCLHDHLCRAS-----AGLNIIYSPLSIHISAAMLRMGTSEGSATAKEMDEGLRFGG 66
            :||::.|||   |.|.|.|     |..:.:.||.|:.....:|..| |||. |..::.:.||...
  Fly    73 SQGVQDFAL---DLLQRISVEVEKANKDFMISPFSVWSLLVLLYEG-SEGE-TRNQLKKSLRINV 132

  Fly    67 LE-----AQQVAESFGVVLKSYEQCQVLKMANGLYVMKGLQVDEQFGHILEQKFRSKPMEIDFGS 126
            .:     |.:|..||..:..|..:...|:   .:|..||..:...:...: |.:..:|||:||.|
  Fly   133 EDEKLRGAYKVWSSFLNITTSTIEVATLQ---AIYTGKGYPIKNNYRDAI-QNYNVQPMEVDFYS 193

  Fly   127 EQAASIINKWVESQTNNLIKDIIGPRVLTKD---SRLCLVNGIHFKGEWSISFNEKETREEDFFG 188
            ..:...||:    .||...:.:|...:|.:|   :::.|::.::|||:|...||:..||||.||.
  Fly   194 PDSVIQINE----DTNRTTRGLIPYTILPQDVYGAKMFLLSSLYFKGQWKFPFNKTLTREEPFFS 254

  Fly   189 SDRPT--RVRMMHVCENF-FFAVLPMFEATALRMNYSACN-LAMIILLPDEKSNLTSLEKKLSDI 249
            .....  ::.||....|| :.:.:...:...|.:.|...: ||||::||.....|..:...|..:
  Fly   255 ESGEVIGKIPMMVQEANFAYVSNVEGLDGYVLELPYGTQDRLAMIVVLPKRGFKLNDVANNLKAL 319

  Fly   250 SLEVV--------SSAMNLEKVDVKIPSFTAEFQQELSQVLMLMGMNRIF-SGQAELGGMLQSEE 305
            .|..:        :.|....:|:|.:|.|.......|..||:.||:..:| ...|.|..|   ..
  Fly   320 GLRPILQRLAAFRNRASEDNEVEVMMPKFVTATDFTLKGVLIQMGIRDLFDENTANLDRM---SS 381

  Fly   306 SLFVSQIVHKAFIEINEVGTEAAAATAAVATFRSMPARQGPPKVFHANRPFFYAIKDNTHG-LLF 369
            .||...:||...|.::|.||.|.|.|.|     ::..:..||| |..||||.|.|.:...| |||
  Fly   382 GLFAKLVVHSTKIIVDEQGTTAGAVTEA-----ALANKATPPK-FLLNRPFQYMIVEKATGLLLF 440

  Fly   370 AG 371
            ||
  Fly   441 AG 442

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DbNP_610244.2 SERPIN 12..373 CDD:238101 112/387 (29%)
Spn77BaNP_001287128.1 SERPIN 75..444 CDD:238101 113/390 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446344
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
54.950

Return to query results.
Submit another query.