DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Db and Acp76A

DIOPT Version :9

Sequence 1:NP_610244.2 Gene:Spn42Db / 35599 FlyBaseID:FBgn0033112 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_524153.1 Gene:Acp76A / 40078 FlyBaseID:FBgn0015586 Length:388 Species:Drosophila melanogaster


Alignment Length:393 Identity:87/393 - (22%)
Similarity:158/393 - (40%) Gaps:87/393 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 YSPLSIHISAAMLRMGTSE-GSATAKEMDEGL------RFGGLEAQQVAESFGVVLKSYEQCQVL 89
            |:|.:..:|...:.|...| .:|.|.|.:..|      .||..||:|....:|:..|.....: .
  Fly    36 YTPENFVLSVLNIEMILFEIHAAKAVESNNDLERSLIINFGYSEARQEVLDWGLRYKKASSAK-F 99

  Fly    90 KMANGLYVMKGLQVDEQFGHILEQKFRSKPMEIDFGSE-QAASIINKWVESQTNNLIKDIIGPRV 153
            :|||.:.|.:.|.:.::. .::.:...:...:.|...: :.:.::::|:.|..:.::.:.:..:.
  Fly   100 QMANKVAVSQKLPLSQKL-RLVNEVLMTSAKKYDVTKDVRPSKLMDEWLSSHLDGVLANFVQEKK 163

  Fly   154 LTKDSRLCLVNGIHFKGEWSISFNEKETREEDFF--------GSDRPTRVRMMHVCENFFFAVLP 210
            |.....:..::|:.....|:..|..:..|   :|        .|..||.|.|||...:  |..:.
  Fly   164 LNAGENIVAISGMTVTPLWASHFQSEINR---YFVNNPGTGYASKDPTCVPMMHSLSS--FETMS 223

  Fly   211 MFEATALRMNYSACNLAMIILLPDEKSNLTSLEKKLSDISLEVVSSAMNLEKVDVK-----IPSF 270
            ..||..:.:.:|:.||.|:||||  :..:|     ..|| |:.:::.:|:|..|.|     :|.|
  Fly   224 TDEAKGIYIPFSSANLGMLILLP--RKGVT-----CKDI-LDNLNNQINVEYNDHKDVHLLLPIF 280

  Fly   271 TAEFQQELSQVLMLMGMNRIFSGQAELGGMLQSEESLFVSQIVHKAFIEINEVGTEAAAATAAVA 335
            ..:|...::         :.|:|       :..|::...|....||.|:||.......       
  Fly   281 KEKFDYNIA---------KFFNG-------INIEDTFKDSAFKSKAKIKINNFRVNHG------- 322

  Fly   336 TFRSMPARQ---------GPPKVFHANRPFFYAIKD-----------NTHGLLFAGHFITTKVEQ 380
             .|..|..:         |..:.|..||||.:.|||           |..||       |.||..
  Fly   323 -IRFQPILRLEVVDDIDTGKTETFEVNRPFVFVIKDKINVYAVGRIENLDGL-------TDKVNC 379

  Fly   381 SEK 383
            |:|
  Fly   380 SKK 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DbNP_610244.2 SERPIN 12..373 CDD:238101 82/381 (22%)
Acp76ANP_524153.1 SERPIN 22..367 CDD:294093 79/369 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.