DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Db and SERPINA2

DIOPT Version :9

Sequence 1:NP_610244.2 Gene:Spn42Db / 35599 FlyBaseID:FBgn0033112 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_006211.2 Gene:SERPINA2 / 390502 HGNCID:8985 Length:421 Species:Homo sapiens


Alignment Length:383 Identity:109/383 - (28%)
Similarity:189/383 - (49%) Gaps:29/383 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 EEFAQGLEQFALCLHDHLCRASAGLNIIYSPLSIHISAAMLRMGTSEGSATAKEMDEGLRFGGLE 68
            ::.:..:...|..|:..|...|...|::.:|.|:.::.|||.:||...:.|  |:.|||.....|
Human    51 QKISYNVTDLAFDLYKELADLSQTSNVLVTPTSVAMAFAMLSLGTKADTRT--EILEGLNVNLTE 113

  Fly    69 AQQ--VAESFGVVLKSYEQCQV-LKMANG--LYVMKGLQVDEQFGHILEQKFRSKPMEIDF-GSE 127
            ..:  :.|.|..||::..:... |::..|  |:|.|.:::.:.|....::.:.|:...|:| .:|
Human   114 TPEAKIHECFQQVLQALSRPDTRLQLTTGSSLFVNKSMKLVDTFLEDTKKLYHSEASSINFRDTE 178

  Fly   128 QAASIINKWVESQTNNLIKDIIGPRVLTKDSRLCLVNGIHFKGEWSISFNEKETREEDFFGSDRP 192
            :|...||.:||.:|...:.|::  :.|.||:.|.||:.|.|.|:|...|..:....|.|...|:.
Human   179 EAKEQINNYVEKRTGRKVVDLV--KHLKKDTSLALVDYISFHGKWKDKFKAEHIMVEGFHVDDKT 241

  Fly   193 -TRVRMMHVCENFFFAVLPMFEATALRMNYSACNLAMIILLPDEKSNLTSLEKKLSDISLEVVSS 256
             .||.|::....|.........:..|..:|.. |.....:|||.| .:..||:||:...||.:..
Human   242 IIRVPMINHLGRFDIHRDRELSSWVLAQHYVG-NATAFFILPDPK-KMWQLEEKLTYSHLENIQR 304

  Fly   257 AMNLEKVDVKIPSFTAEFQQELSQVLMLMGMNRIFSGQAELGGMLQSEESLFVSQIVHKAFIEIN 321
            |.::..:::..|..:.....:|.:||..:|:.:|||.:|:|.|:.| |..|.:|:.||.|.:.|:
Human   305 AFDIRSINLHFPKLSISGTYKLKRVLRNLGITKIFSNEADLSGVSQ-EAPLKLSKAVHVAVLTID 368

  Fly   322 EVGTEAAAA----TAAVATFRSMPARQGPPKVFHANRPFFYAIKDN-THGLLFAGHFI 374
            |.||||..|    ..|.:.::::        :|  ||||...|||: |:..||.|..:
Human   369 EKGTEATGAPHLEEKAWSKYQTV--------MF--NRPFLVIIKDDITNFPLFIGKVV 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DbNP_610244.2 SERPIN 12..373 CDD:238101 109/372 (29%)
SERPINA2NP_006211.2 SERPIN 62..418 CDD:214513 108/372 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S7631
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.960

Return to query results.
Submit another query.