DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Db and Serpinb3b

DIOPT Version :9

Sequence 1:NP_610244.2 Gene:Spn42Db / 35599 FlyBaseID:FBgn0033112 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_941373.1 Gene:Serpinb3b / 383548 MGIID:2683293 Length:387 Species:Mus musculus


Alignment Length:387 Identity:129/387 - (33%)
Similarity:207/387 - (53%) Gaps:41/387 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 QFALCLHDHLCRASAGLNIIYSPLSIHISAAMLRMGTSEGSATAKEMDEGLRFGGLEA------- 69
            :||:.::..|  ..:..||.|||:|:..:.|||::| ::|: |..::::.|:|  :|.       
Mouse    10 KFAVEMYRQL--RESDKNIFYSPISMMTALAMLQLG-AKGN-TEIQIEKVLQF--IETTKKTTEK 68

  Fly    70 -------QQVAESFGVVL----KSYEQCQVLKMANGLYVMKGLQVDEQFGHILEQKFRSKPMEID 123
                   :.|.|.|..::    ||.:... ||.||.:|..||....:.|...:::.:::|...:|
Mouse    69 SEHCDDEENVHEQFQKLITQLNKSNDDYD-LKAANSIYGAKGFPFLQTFLEDIKEYYQAKVESLD 132

  Fly   124 F--GSEQAASIINKWVESQTNNLIKDIIGPRVLTKDSRLCLVNGIHFKGEWSISFNEKETREEDF 186
            |  .:|::...||.||||:||..|||:.....|:..:.|.|||.::|||:|:..|||..||||.|
Mouse   133 FEHATEESEKKINSWVESKTNGKIKDLFPSGSLSSSTILVLVNAVYFKGQWNRKFNENHTREEKF 197

  Fly   187 F---GSDRPTRVRMMHVCENFFFAVLPMFEATALRMNYSACNLAMIILLPDEKSNLTSLEKKL-S 247
            :   .:.:|  |:||.....|.|:.|....|..:.:.|...:|:|.:|||.|...|..||::| :
Mouse   198 WLNKNTSKP--VQMMKQRNKFNFSFLGDVHAQIVEIPYKGKDLSMFVLLPMEIDGLKQLEEQLTT 260

  Fly   248 DISLE-VVSSAMNLEKVDVKIPSFTAEFQQELSQVLMLMGMNRIFSGQ-AELGGMLQSEESLFVS 310
            |..|| :.:..|:|.::.:.:|.|..|.:.:|...|..|||...|..| |:..|| .|...|.||
Mouse   261 DKLLEWIKAENMHLTELYLSLPRFKVEEKYDLQVPLEHMGMVDAFDPQKADFSGM-SSIPGLVVS 324

  Fly   311 QIVHKAFIEINEVGTEAAAATAAVATFRSMPARQGPPKVFHANRPF-FYAIKDNTHGLLFAG 371
            :::||:|:|:||.||||||||....:.||....:.    |..:.|| |:.|...|:.:||.|
Mouse   325 KVLHKSFVEVNEEGTEAAAATGVEVSVRSAQIAED----FCCDHPFLFFIIHRMTNSILFFG 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DbNP_610244.2 SERPIN 12..373 CDD:238101 129/387 (33%)
Serpinb3bNP_941373.1 SERPIN 6..387 CDD:294093 129/387 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBFJ
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.830

Return to query results.
Submit another query.