DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Db and Serpinb9

DIOPT Version :9

Sequence 1:NP_610244.2 Gene:Spn42Db / 35599 FlyBaseID:FBgn0033112 Length:388 Species:Drosophila melanogaster
Sequence 2:XP_006253934.1 Gene:Serpinb9 / 361241 RGDID:1549730 Length:396 Species:Rattus norvegicus


Alignment Length:379 Identity:112/379 - (29%)
Similarity:198/379 - (52%) Gaps:36/379 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 FALCLHDHLCRASAGLNIIYSPLSIHISAAMLRMGTSEGSATAKEMDEGLRFGGLEAQQ-VAESF 76
            ||:.|...||:::...|:.|||:||..:.||:.:|..  ..|..::.:.|   ||..:: :.:.|
  Rat    33 FAIHLLKMLCQSNPSENVCYSPVSISSALAMVLLGAK--GQTQVQISQAL---GLNKEKDLHQGF 92

  Fly    77 GVVLKSY---EQCQVLKMANGLYVMKGLQVDEQFGHILEQKFRSKPMEIDF--GSEQAASIINKW 136
            .::|.:.   |:...|::||.|:..|..::...:.....:.:.|:..::.|  .:|::...||.|
  Rat    93 QLLLSNLNKPERKYSLRVANRLFADKTCELLPTYKESCLRFYNSEMEQLSFAEAAEESRKHINTW 157

  Fly   137 VESQTNNLIKDIIGPRVLTKDSRLCLVNGIHFKGEWSISFNEKETREEDFFGSDRPTRVRMMHVC 201
            |..||...|.:::....:..::||.|||.::|||.|...||::.|.:..|..:....|:..|..|
  Rat   158 VSKQTEGKIPELLSGGSVDSETRLVLVNALYFKGRWHQPFNKEYTVDMPFKINKNEKRLVQMMCC 222

  Fly   202 ENFF-FAVLPMFEATALRMNYSACNLAMIILLPDEKSNLTSLEKKLSDISLEVVSSAMNLE---- 261
            |:.: .|.:...:|..|.|.|....|:.::||||...:|:.:|   |:::.|.:::..|.:    
  Rat   223 EDTYNLAHVKEVQAQVLMMPYEGMELSFVVLLPDNDGDLSKVE---SNLTFEKLTAWTNPDFMKN 284

  Fly   262 -KVDVKIPSFTAEFQQELSQVLMLMGMNRIF-SGQAELGGMLQSEESLFVSQIVHKAFIEINEVG 324
             .|:|.:|.|..:...::..|...:|:..:| ..:|:|..| ..|.:|.||:||||:.:|:||.|
  Rat   285 TNVEVFLPKFKLQEDYDMESVFQRLGIVDVFQEAKADLSAM-SPERNLCVSKIVHKSLVEVNEEG 348

  Fly   325 TEAAAATAAV----ATFRSMPARQGPPKVFHANRPFFYAIKDN-THGLLFAGHF 373
            ||||||:|.:    |.|  :|       .|.|:.||.:.||.| |:.:||.|.|
  Rat   349 TEAAAASAVIEYCCAAF--VP-------TFCADHPFLFFIKHNKTNSILFCGRF 393

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DbNP_610244.2 SERPIN 12..373 CDD:238101 111/377 (29%)
Serpinb9XP_006253934.1 SERPIN 26..396 CDD:294093 112/379 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBFJ
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X28
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.830

Return to query results.
Submit another query.