DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Db and Spn31A

DIOPT Version :9

Sequence 1:NP_610244.2 Gene:Spn42Db / 35599 FlyBaseID:FBgn0033112 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_609341.1 Gene:Spn31A / 34339 FlyBaseID:FBgn0032178 Length:382 Species:Drosophila melanogaster


Alignment Length:395 Identity:99/395 - (25%)
Similarity:170/395 - (43%) Gaps:68/395 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 CRASAGL-----------NIIYSPLSIHISAAMLRMGTSEGSATAKEMDEGLRF------GGLEA 69
            |...||:           |::.|||.:..:.::|.:| |:| |||:|:.:.||.      ....|
  Fly    12 CHIGAGIYHSIATSFAEQNVVVSPLLLEATLSLLFLG-SDG-ATAEELQKQLRLKQRFASNAKMA 74

  Fly    70 QQVAESFGVVLKSYEQCQVLKMANGLYVMKGLQVDEQFGHILEQKFRSKPMEIDFG--------- 125
            ...|...|.:....:  ..|::.|.|.:.....|.:.|..|.:..|.:....:|..         
  Fly    75 NFYAAELGNITTDAD--TFLQLQNRLMLSSESGVADDFQKIAQTYFHATAECVDLEQTEKLRRHI 137

  Fly   126 SEQAASII--NKWVE------SQTNNLIKDIIGPRVLTKDSRLCLVNGIHFKGEWSISFNEKETR 182
            |||..:.:  ..|.:      |..|.|:                |:...:.:.:|.:.|:...|.
  Fly   138 SEQILASVGGGSWKDIHVAGGSSANTLL----------------LLLAANLQSKWFLPFSAYRTG 186

  Fly   183 EEDFFGSDRPTRVRMMHVCENFF-FAVLPMFEATALRMNYS-ACNLAMIILLPDEKSNLTSLEKK 245
            ..:|....:...|.|:...:.|. ||.|...:|.|:.:.|. |..|:|:::||:::..|..|||:
  Fly   187 LYEFHSGSQVKSVPMLFDDDMFVKFAELRDLDARAIELPYEHAEELSMLLILPNQRGGLQELEKQ 251

  Fly   246 LSDISLEVVSSAMNLEKVDVKIPSFTAEFQQELSQVLMLMGMNRIFSGQAELGGMLQSEESLFVS 310
            |.|:.|..:...|.:|.|.|.:|.|:.:|:..|.|.|..:|...||:..|.. ..|.:..:|.::
  Fly   252 LHDLDLGALQQRMQMEGVQVLLPKFSIDFECSLRQPLKQLGFEEIFAASANF-KHLHASANLPIA 315

  Fly   311 QIVHKAFIEINEVGTEAAA-----ATAAVATFRSMPARQGPPKVFHANRPFFYAIK-DNTHGLLF 369
            .::.|..|.:||.|:.:..     ||.......|..:||   |.|.|:.|||:||: :|...|: 
  Fly   316 DVLQKLRINLNESGSGSGPELPKNATEYKPIVISNSSRQ---KFFRADHPFFFAIRSENVTYLM- 376

  Fly   370 AGHFI 374
             ||.:
  Fly   377 -GHVV 380

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DbNP_610244.2 SERPIN 12..373 CDD:238101 98/392 (25%)
Spn31ANP_609341.1 SERPIN 18..379 CDD:238101 95/386 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449396
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D140751at6656
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.