DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Db and Serpina7

DIOPT Version :9

Sequence 1:NP_610244.2 Gene:Spn42Db / 35599 FlyBaseID:FBgn0033112 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_808588.3 Gene:Serpina7 / 331535 MGIID:3041197 Length:426 Species:Mus musculus


Alignment Length:373 Identity:107/373 - (28%)
Similarity:178/373 - (47%) Gaps:22/373 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 FALCLHDHLCRASAGLNIIYSPLSIHISAAMLRMGTSEGSATAKEMDEGLRFG-----GLEAQQV 72
            ||..|:..|...:..|||.:||:||.::.|||..|:  ||:|..::.|.|.|.     ..|.||.
Mouse    60 FAFSLYRRLSVENPDLNIFFSPVSISVALAMLSFGS--GSSTQTQILEVLGFNLTDTPVTELQQG 122

  Fly    73 AESFGVVLKSYEQCQVLKMANGLYVMKGLQVDEQFGHILEQKFRSKPMEIDFGSEQAAS-IINKW 136
            .:.....|...:....|:|.|.:::.:.|:...:|...::..:.::....||.:..||. .||.:
Mouse   123 FQHLICSLNFPKNELELQMGNAVFIGQQLKPLAKFLDDVKTLYETEVFSTDFSNVSAAQHKINSY 187

  Fly   137 VESQTNNLIKDIIGPRVLTKDSRLCLVNGIHFKGEWSISFNEKETREEDFFGSDRPTRVR--MMH 199
            ||.||...|..:|  :.|..:..:.|||.|||:.:|:..|...:|.|...|..|:.|.|:  |||
Mouse   188 VEKQTKGKIVGLI--QGLKLNIIMILVNYIHFRAQWANPFRVSKTEESSNFSVDKSTTVQVPMMH 250

  Fly   200 VCENFFFAVLPMFEATALRMNYSACNLAMIILLPDEKSNLTSLEKKLSDISLEVVSSAMNLEKVD 264
            ..|.::..|......|.|:|:||...||:.: ||.| .::..:|..:|..:|:..:..:....|:
Mouse   251 QLEQYYHYVDMELNCTVLQMDYSENALALFV-LPKE-GHMEWVEAAMSSKTLKKWNYLLQKGWVE 313

  Fly   265 VKIPSFTAEFQQELSQVLMLMGMNRIFSGQAELGGMLQSEESLFVSQIVHKAFIEINEVGTEAAA 329
            :.:|.|:.....:|...|..|||...|:..|:..|:.: :..|.:|...|||.:.|.|.||:..|
Mouse   314 LFVPKFSISATYDLGSTLQKMGMRDAFAESADFPGITE-DSGLKLSYAFHKAVLHIGEEGTKEGA 377

  Fly   330 ATAAVATFRSMPARQGPP--KVFHANRPFFYAI-KDNTHGLLFAGHFI 374
            :...    .|:..::.||  .|...:|.|...| :..|..:||.|..:
Mouse   378 SPEV----GSLDQQEVPPLHPVIRLDRAFLLMILEKRTRSVLFLGKLV 421

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DbNP_610244.2 SERPIN 12..373 CDD:238101 107/370 (29%)
Serpina7NP_808588.3 alpha-1-antitrypsin_like 57..419 CDD:239011 106/369 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.