DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Db and SERPINA9

DIOPT Version :9

Sequence 1:NP_610244.2 Gene:Spn42Db / 35599 FlyBaseID:FBgn0033112 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_783866.3 Gene:SERPINA9 / 327657 HGNCID:15995 Length:417 Species:Homo sapiens


Alignment Length:386 Identity:120/386 - (31%)
Similarity:175/386 - (45%) Gaps:35/386 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 FALCLHDHLCRASAGLNIIYSPLSIHISAAMLRMGTSEGSATAKEMDEGLRFGGLEA-------- 69
            ||..|:..|...:...||.:||:|:..|.|||.:|..  |.|..::.:||.|.....        
Human    51 FAFRLYRRLVLETPSQNIFFSPVSVSTSLAMLSLGAH--SVTKTQILQGLGFNLTHTPESAIHQG 113

  Fly    70 -QQVAESFGVVLKSYEQCQVLKMANGLYVMKGLQVDEQFGHILEQKFRSKPMEIDFGSEQAASI- 132
             |.:..|..|..|..    .|||.:.|:|.|.||:...|...:::.:.::....||.:...|.. 
Human   114 FQHLVHSLTVPSKDL----TLKMGSALFVKKELQLQANFLGNVKRLYEAEVFSTDFSNPSIAQAR 174

  Fly   133 INKWVESQTNNLIKDII-GPRVLTKDSRLCLVNGIHFKGEWSISFNEKETREEDFF--GSDRPTR 194
            ||..|:.:|...:.||| |..:||   .:.|||.|.||.:|...|:.:.||:...|  |......
Human   175 INSHVKKKTQGKVVDIIQGLDLLT---AMVLVNHIFFKAKWEKPFHPEYTRKNFPFLVGEQVTVH 236

  Fly   195 VRMMHVCENFFFAVLPMFEATALRMNYSACNLAMIILLPDEKSNLTSLEKKLSDISLEVVSSAMN 259
            |.|||..|.|.|.|........|:|:|....:|..:|  ..|..:..||:.||..:|...|.::.
Human   237 VPMMHQKEQFAFGVDTELNCFVLQMDYKGDAVAFFVL--PSKGKMRQLEQALSARTLRKWSHSLQ 299

  Fly   260 LEKVDVKIPSFTAEFQQELSQVLMLMGMNRIFSGQAELGGMLQSEESLFVSQIVHKAFIEINEVG 324
            ...::|.||.|:......|..:|..||:..:|...|:..| :...:||.||:..|||.::::|.|
Human   300 KRWIEVFIPRFSISASYNLETILPKMGIQNVFDKNADFSG-IAKRDSLQVSKATHKAVLDVSEEG 363

  Fly   325 TEAAAATAAVATFRSMPARQGPPK-VFHANRPFFYAIKDN-THGLLFAGHFITTKVEQSEK 383
            |||.|||......||   :.||.. ....||.|...|.:. |.|:||.|     |||...|
Human   364 TEATAATTTKFIVRS---KDGPSYFTVSFNRTFLMMITNKATDGILFLG-----KVENPTK 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DbNP_610244.2 SERPIN 12..373 CDD:238101 116/374 (31%)
SERPINA9NP_783866.3 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.