DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Db and serpina1

DIOPT Version :9

Sequence 1:NP_610244.2 Gene:Spn42Db / 35599 FlyBaseID:FBgn0033112 Length:388 Species:Drosophila melanogaster
Sequence 2:XP_017207927.1 Gene:serpina1 / 322701 ZFINID:ZDB-GENE-030131-1421 Length:433 Species:Danio rerio


Alignment Length:371 Identity:108/371 - (29%)
Similarity:184/371 - (49%) Gaps:29/371 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 FALCLHDHLCR--ASAGLNIIYSPLSIHISAAMLRMGTSEGSATAKEMDEGLRFGGLEAQQVAES 75
            ||..|:..|..  ...|.||.:||:.|.::.::|.:|..  ::|..::..||.:..|..:||.|.
Zfish    73 FAFSLYKKLASNPDGQGKNIFFSPVGISMALSLLAVGAK--ASTLSQIYSGLGYSALTPEQVNEG 135

  Fly    76 FGVVLKSY---EQCQVLKMANGLYVMKGLQVDEQFGHILEQKFRSKPMEIDFGS-EQAASIINKW 136
            :..:|...   :....|:...|:.:..|.:|.:||....:..:.|:...:||.. |.||:.|||:
Zfish   136 YEHLLHMLGHSQDAMQLEAGAGVAIRDGFKVVDQFLKDAQHYYNSEAFGVDFSKPEIAAAEINKF 200

  Fly   137 VESQTN----NLIKDIIGPRVLTKDSRLCLVNGIHFKGEWSISFNEKETREEDF-FGSDRPTRVR 196
            :..:|:    |::||      |..|:.:.|:|.::|:|:|...|:.|.|.:.|| ...|...:|.
Zfish   201 IARKTHDKITNMVKD------LDADTVMMLINYMYFRGKWEKPFDAKLTHKADFKVDQDTTVQVD 259

  Fly   197 MMHVCENFFFAVLPMFEATALRMNYSACNLAMIILLPDEKSNLTSLEKKLSDISLEVVSSAMNLE 261
            ||.....:.....|:.:.|.:.:.|.. |.:|:|:|||: ..:..||:.:....|:.....:...
Zfish   260 MMKRTGRYDIYQDPVNQTTVMMVPYKG-NTSMMIVLPDD-GKMKELEESICRHHLKNWHDKLFRS 322

  Fly   262 KVDVKIPSFTAEFQQELSQVLMLMGMNRIFSGQAELGGMLQSEESLFVSQIVHKAFIEINEVGTE 326
            .||:.:|.|:.....:|..:|..|||...|:.:|:..||.: |..:.|||::|:|.:.::|.|||
Zfish   323 SVDLFMPKFSISATSKLDGILKDMGMTDAFNDKADFSGMTE-EVKVKVSQVLHQAVMSVDEKGTE 386

  Fly   327 AAAATAAVATFRSMPARQGPPKVFHANRPFFYAI-KDNTHGLLFAG 371
            |||.|    |...||  ...|.....||||...| :|:|..:||.|
Zfish   387 AAAIT----TIEIMP--MSLPDTVILNRPFLVLIVEDSTMSILFMG 426

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DbNP_610244.2 SERPIN 12..373 CDD:238101 108/371 (29%)
serpina1XP_017207927.1 alpha-1-antitrypsin_like 69..428 CDD:239011 108/371 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.