DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Db and Serpine3

DIOPT Version :9

Sequence 1:NP_610244.2 Gene:Spn42Db / 35599 FlyBaseID:FBgn0033112 Length:388 Species:Drosophila melanogaster
Sequence 2:XP_017171543.1 Gene:Serpine3 / 319433 MGIID:2442020 Length:404 Species:Mus musculus


Alignment Length:395 Identity:89/395 - (22%)
Similarity:173/395 - (43%) Gaps:60/395 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 AQGL----EQFALCLHDHLCRASA----GLNIIYSPLSIHISAAMLRMGTSEGSATAKEMDEGLR 63
            ::||    .:|||    ||.|::|    |.|.:.||.|:.:|..:|:.| :.|:.       |.:
Mouse    25 SEGLWLLKTEFAL----HLYRSAAAERNGTNFVISPASVSLSLEILQFG-ARGNT-------GWQ 77

  Fly    64 FGG-----LEAQQVAESFGVVL---KSYEQCQVLKMANGLYVMKGLQVDEQFGHILEQKFRSKPM 120
            ..|     ::..:|.|....|.   .:..|...:::|..|::..|..:...|...:.:...|...
Mouse    78 LAGALGYTVQDPRVKEFLHAVYTTRHNSSQGVGMELACTLFMQTGTSLSPCFVEQVSRWANSSLE 142

  Fly   121 EIDFG-----SEQAASIINKWVESQTNNLIKDIIGP------RVLTKDSRLCLVNGIHFKGEWSI 174
            ..||.     :.:|:.:.::....:         ||      |.....::|.:::.:.|:..|..
Mouse   143 AADFSEPNSTTTEASKVTSRQSTGE---------GPDSPLWGRADALSTQLSIMSTMTFQSTWQK 198

  Fly   175 SFNEKETREEDFFGSDRPTRVRMMH-VCENFF--FAVLPMFEATALRMNYSACNLAMIILLPDEK 236
            .|:................:|..|| |.|..:  |......|...|.:.|.....:::::||.:|
Mouse   199 RFSVVLQPLPFTHAHGLVLQVPAMHQVAEVSYGQFQDAAGHEIAVLELLYLGRVASLLLVLPQDK 263

  Fly   237 SN-LTSLEKKLSDISLEVVSSAMNLEKVDVKIPSFTAEFQQELSQVLMLMGMNRIFSG-QAELGG 299
            .. |..:|..|:...|.:.::.:...::||.:|.|..:.|.::..:|...|:..:|.. :|.|.|
Mouse   264 GTPLDHIEPHLTARVLHLWTTRLKRARMDVFLPRFKIQNQFDVKSILRSWGITDLFDPLKANLKG 328

  Fly   300 MLQSEESLFVSQIVHKAFIEINEVGTEAAAATAAVATFRSMPARQGPPKVFHANRPFFYAIKDNT 364
             :..::..:|||:.|||.:|::|.||.::||||.:...||..:      .|.|:|||.:.:::::
Mouse   329 -ISGQDGFYVSQLTHKAKMELSEEGTRSSAATAVLLLRRSRTS------AFKADRPFIFLLREHS 386

  Fly   365 HGLLF 369
            .|..|
Mouse   387 TGTDF 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DbNP_610244.2 SERPIN 12..373 CDD:238101 87/386 (23%)
Serpine3XP_017171543.1 serpin 20..388 CDD:393296 87/390 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.110

Return to query results.
Submit another query.