DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Db and RGD1562844

DIOPT Version :9

Sequence 1:NP_610244.2 Gene:Spn42Db / 35599 FlyBaseID:FBgn0033112 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_001333297.1 Gene:RGD1562844 / 306892 RGDID:1562844 Length:296 Species:Rattus norvegicus


Alignment Length:261 Identity:81/261 - (31%)
Similarity:137/261 - (52%) Gaps:7/261 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 LKSYEQCQVLKMANGLYVMKGLQVDEQFGHILEQKFRSKPMEIDF--GSEQAASIINKWVESQTN 142
            |...|:...|:||||::|.|..:|...|.....:.:.|:..::.|  .:|::...:|.||..||.
  Rat    27 LNKSERYFSLRMANGIFVDKTCEVLPTFKESCLRFYNSEMEQLSFAEAAEESRKHVNTWVSKQTE 91

  Fly   143 NLIKDIIGPRVLTKDSRLCLVNGIHFKGEWSISFNEKETREEDFFGSDRPTR-VRMMHVCENFFF 206
            ..|.:::....:...:||.|||.::.|..|...|:|..|||..|..:...|| |:||:....|.:
  Rat    92 GKIPELLPDDSVDFQTRLVLVNALYLKATWGRQFDEGSTREMPFKINKNETRPVQMMYQEGIFCY 156

  Fly   207 AVLPMFEATALRMNYSACNLAMIILLPDEKSNLTSLEKKLS--DISLEVVSSAMNLEKVDVKIPS 269
            ..:....|:.|.:.|....|..::|||||..:::.:|::|:  .::.......|:...|:|.:|.
  Rat   157 KYVKEVPASLLMIPYKGDELCFLVLLPDESVDISKVEEELTFEKLTAWTQPDTMSYTHVEVFLPK 221

  Fly   270 FTAEFQQELSQVLMLMGMNRIF-SGQAELGGMLQSEESLFVSQIVHKAFIEINEVGTEAAAATAA 333
            |..|...:|..:|..:|:...| ..:|:|..| ..|.:|.||:.|||:.:|:||.|||||||.::
  Rat   222 FKLEEDYDLKSLLQRLGIVDAFEETKADLSAM-APERNLCVSKFVHKSVVEVNEKGTEAAAAASS 285

  Fly   334 V 334
            |
  Rat   286 V 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DbNP_610244.2 SERPIN 12..373 CDD:238101 81/261 (31%)
RGD1562844NP_001333297.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X28
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.