DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Db and Serpinb9d

DIOPT Version :9

Sequence 1:NP_610244.2 Gene:Spn42Db / 35599 FlyBaseID:FBgn0033112 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_001100821.1 Gene:Serpinb9d / 306890 RGDID:1308725 Length:337 Species:Rattus norvegicus


Alignment Length:336 Identity:95/336 - (28%)
Similarity:172/336 - (51%) Gaps:27/336 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 TAKEMDEGLRFGGLEAQQVAESFGVVLKSYEQ-----CQVLKMANGLYVMKGLQVDEQFGHILEQ 113
            ||.::.:.|.......:.:.:.|.::|.:..:     |  |::||.|:.....::...:.....:
  Rat    10 TAVQISQALNLNKHPDEDIHKDFQLLLHNLNKPKSHYC--LRIANRLFAENTCKLVPTYKESCLR 72

  Fly   114 KFRSKPMEIDF--GSEQAASIINKWVESQTNNLIKDIIGPRVLTKDSRLCLVNGIHFKGEWSISF 176
            .:.|:..::.|  .:|::...||.||..||...|.:::....:..:::|.:||.::|:|.|...|
  Rat    73 FYNSEIEQLSFAKAAEESRKHINTWVSKQTEGKIPELLSSDSVGSETKLIMVNALYFQGSWLHCF 137

  Fly   177 NEKETREEDFFGSDRPTR-VRMMHVCENFFFAVLPMFEATALRMNYSACNLAMIILLPDEKSNLT 240
            :::.|.|..|..:.:.|: |:||...|.|..|.:...:|..|.|.|....::.::|||||..::.
  Rat   138 DKEFTMEMPFKINKKETKPVQMMWQEETFDVAYVKEIQAQILVMPYRGMEMSFMVLLPDEGVDIR 202

  Fly   241 SLEKKLSDISL------EVVSSAMNLEKVDVKIPSFTAEFQQELSQVLMLMGMNRIFSG-QAELG 298
            .:|..|:...|      |.:.|.    :|.|.:|.|..:.|.:::.:...:||..:||. :|:|.
  Rat   203 KVESSLTFEKLTAWTKPEFIYST----EVYVYLPKFQLQEQYDMTALFQHLGMIDVFSEIKADLS 263

  Fly   299 GMLQSEESLFVSQIVHKAFIEINEVGTEAAAATAAVATFRSMPARQGPPKVFHANRPFFYAIKDN 363
            ||. .|:.|.||:.||:..:|:||.|||||||:||...:   ...:..| .|.|:|||.:.|:.|
  Rat   264 GMC-PEKDLCVSKFVHECVVEVNEEGTEAAAASAADCCY---SCSEYTP-TFCADRPFLFFIRHN 323

  Fly   364 -THGLLFAGHF 373
             |:.:||.|.|
  Rat   324 QTNSILFCGRF 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DbNP_610244.2 SERPIN 12..373 CDD:238101 94/334 (28%)
Serpinb9dNP_001100821.1 SERPIN 1..337 CDD:294093 95/336 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBFJ
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X28
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.830

Return to query results.
Submit another query.