DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Db and RGD1564786

DIOPT Version :9

Sequence 1:NP_610244.2 Gene:Spn42Db / 35599 FlyBaseID:FBgn0033112 Length:388 Species:Drosophila melanogaster
Sequence 2:XP_006253935.2 Gene:RGD1564786 / 306889 RGDID:1564786 Length:420 Species:Rattus norvegicus


Alignment Length:393 Identity:109/393 - (27%)
Similarity:188/393 - (47%) Gaps:39/393 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 FALCLH------DHLCRASAGL--------------NIIYSPLSIHISAAMLRMGTSEGSAT--- 54
            |.:.||      |.|.:|:...              |:.:|..||..:.:|:.||.:..:|:   
  Rat    32 FIVILHSRLTIMDPLLKANGNFAIKLFKVLGEDISKNVFFSLPSISSALSMILMGANGTTASQIC 96

  Fly    55 -AKEMDEGLRFGGLEA-QQVAESFGVVLKSYEQCQVLKMANGLYVMKGLQVDEQFGHILEQKFRS 117
             |..:|:....||.:. |........|.|:..:| :|:.||.:::....::...|.....:.:.:
  Rat    97 QAMSLDKCNSIGGGDVHQHFLSLLTKVNKTDTRC-MLRKANSVFIEDSFEILASFKDACHKLYEA 160

  Fly   118 KPMEIDF--GSEQAASIINKWVESQTNNLIKDIIGPRVLTKDSRLCLVNGIHFKGEWSISFNEKE 180
            :..|:||  ..||:...||.||..:|.::|::::.|..:..::.|.|||.|:|||.....||:.:
  Rat   161 EIEELDFKGAPEQSRQHINTWVAKKTEDIIRELLPPCTVNSNTCLFLVNVIYFKGSLEKPFNKAD 225

  Fly   181 TREEDF-FGSDRPTRVRMMHVCENFFFAVLPMFEATALRMNYSACNLAMIILLPDEKSNLTSLEK 244
            |||..| ...:....|:||.....|....:.......|.:.:....|:|...:||.......||.
  Rat   226 TREMPFKVSMNEKKTVQMMSQKSTFKMTYVKDISTQVLTLPFENSILSMYFFVPDSHVAQRKLEN 290

  Fly   245 KLS-DISLE-VVSSAMNLEKVDVKIPSFTAEFQQELSQVLMLMGMNRIF-SGQAELGGMLQSEES 306
            :|: |..|| .....|..::::|.:|....|...:::.||..:||...| ..:|:..| :.|:..
  Rat   291 ELTYDKFLEWTDEDTMEEKEMEVFLPRIKLEESYDMNGVLRKLGMTDAFEEDKADFSG-ISSKHG 354

  Fly   307 LFVSQIVHKAFIEINEVGTEAAAATAAVATFRSMPARQGPPKVFHANRPFFYAIKD-NTHGLLFA 370
            ||:|::|||:|:|::|.||||||.| .|.|.:| |.   .|:...|:.||.::|:| .:..:||.
  Rat   355 LFLSKVVHKSFVEMSEEGTEAAAPT-DVVTMKS-PL---TPRCLIADHPFLFSIQDTRSKEILFL 414

  Fly   371 GHF 373
            |.|
  Rat   415 GRF 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DbNP_610244.2 SERPIN 12..373 CDD:238101 108/391 (28%)
RGD1564786XP_006253935.2 SERPIN 46..420 CDD:294093 105/379 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.