DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Db and SERPIND1

DIOPT Version :9

Sequence 1:NP_610244.2 Gene:Spn42Db / 35599 FlyBaseID:FBgn0033112 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_000176.2 Gene:SERPIND1 / 3053 HGNCID:4838 Length:499 Species:Homo sapiens


Alignment Length:372 Identity:94/372 - (25%)
Similarity:158/372 - (42%) Gaps:59/372 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 NIIYSPLSIHISAAMLRMGTSEGSATAKEMDEGLRFGG-------------------LEAQQVAE 74
            ||..:|:.|..:..|:.:|..  ..|.:::...|.|..                   |..:....
Human   150 NIFIAPVGISTAMGMISLGLK--GETHEQVHSILHFKDFVNASSKYEITTIHNLFRKLTHRLFRR 212

  Fly    75 SFGVVLKSYEQCQVLKMANGLYVMKGLQVDEQFGHILEQKFRSKPMEIDFGSEQAASIINKWVES 139
            :||..|:|         .|.||:.|      ||..:|:  |::|..|..|...|.|...:....|
Human   213 NFGYTLRS---------VNDLYIQK------QFPILLD--FKTKVREYYFAEAQIADFSDPAFIS 260

  Fly   140 QTNN--------LIKDIIGPRVLTKDSRLCLVNGIHFKGEWSISFNEKETREEDFFGSDRP-TRV 195
            :|||        ||||.:  ..:...:::.::|.|:|||.|...|..:.|...:|..::|. .:|
Human   261 KTNNHIMKLTKGLIKDAL--ENIDPATQMMILNCIYFKGSWVNKFPVEMTHNHNFRLNEREVVKV 323

  Fly   196 RMMHVCENFFFAVLPMFEATALRMNYSACNLAMIILLPDEKSNLTSLEKKLSDISLEVVSSAMNL 260
            .||....||..|.....:...|::.|.. .::|:|::|.:.|.:.:||.:|:...:|....:|..
Human   324 SMMQTKGNFLAANDQELDCDILQLEYVG-GISMLIVVPHKMSGMKTLEAQLTPRVVERWQKSMTN 387

  Fly   261 EKVDVKIPSFTAEFQQELSQVLMLMGMNRIFSGQAELGGMLQSEESLFVSQIVHKAFIEINEVGT 325
            ...:|.:|.|..|....|.:.|.|||:..:|.....:.|:  |::.:.:....|:..|.:||.||
Human   388 RTREVLLPKFKLEKNYNLVESLKLMGIRMLFDKNGNMAGI--SDQRIAIDLFKHQGTITVNEEGT 450

  Fly   326 EAAAATAAVATFRSMPARQGPPKVFHANRPFFYAIKDN-THGLLFAG 371
            :|...|.......|...|      |..:|||.:.|.:: |..|||.|
Human   451 QATTVTTVGFMPLSTQVR------FTVDRPFLFLIYEHRTSCLLFMG 491

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DbNP_610244.2 SERPIN 12..373 CDD:238101 94/372 (25%)
SERPIND1NP_000176.2 HCII 62..497 CDD:239002 94/372 (25%)
Chemotactic activity 68..79
2 X 11 AA approximate repeats, Asp/Glu-rich (acidic) (hirudin-like) 73..97
Glycosaminoglycan-binding site 192..212 1/19 (5%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.