DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Db and Serpinc1

DIOPT Version :9

Sequence 1:NP_610244.2 Gene:Spn42Db / 35599 FlyBaseID:FBgn0033112 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_001012027.1 Gene:Serpinc1 / 304917 RGDID:1307404 Length:465 Species:Rattus norvegicus


Alignment Length:390 Identity:120/390 - (30%)
Similarity:198/390 - (50%) Gaps:38/390 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 EFAQGLEQFALCLHDHLCRA-SAGLNIIYSPLSIHISAAMLRMGTSEGSATAKEMDEGLRFGGLE 68
            |.::...:||...:.||..: :...||..|||||..:.||.::|....  |.|::.|..:|..:.
  Rat    83 ELSKANSRFATNFYQHLADSKNDNDNIFLSPLSISTAFAMTKLGACNN--TLKQLMEVFKFDTIS 145

  Fly    69 ---AQQVAESFGVVLKSYEQCQV---------LKMANGLYVMKGLQVDEQFGHILEQKFRSKPME 121
               :.|:...|..:     .|::         |..||.|:..|.|..:|.:..:.|..:.:|...
  Rat   146 EKTSDQIHFFFAKL-----NCRLYRKANKSSNLVSANRLFGDKSLTFNESYQDVSEIVYGAKLQP 205

  Fly   122 IDF--GSEQAASIINKWVESQTNNLIKDIIGPRVLTKDSRLCLVNGIHFKGEWSISFNEKETREE 184
            :||  ..||:...||.||.::|...|||:|....:.:.:.|.|||.|:|||.|...|:.:.||:|
  Rat   206 LDFKENPEQSRVTINNWVANKTEGRIKDVIPQGAIDELTALVLVNTIYFKGLWKSKFSPENTRKE 270

  Fly   185 DFFGSD-RPTRVRMMHVCENFFFAVLPMFEAT-ALRMNYSACNLAMIILLPDEKSNLTSLEKKLS 247
            .|...| :...|.||:  :...|....:.|.| .|.|.:...::.|:::||..:.:|..:|::|:
  Rat   271 PFHKVDGQSCLVPMMY--QEGKFKYRRVGEGTQVLEMPFKGDDITMVLILPKPEKSLAKVEQELT 333

  Fly   248 DISLEVVSSAMNLEKVDVKIPSFTAEFQQELSQVLMLMGMNRIFSGQ-AELGGML-QSEESLFVS 310
            ...|:.....::...:.|.:|.|..|....|.:.|..||:..:||.: ::|.|:: :..:.||||
  Rat   334 PELLQEWLDELSEVMLVVHVPRFRIEDSFSLKEQLQDMGLVDLFSPEKSQLPGIIAEGRDDLFVS 398

  Fly   311 QIVHKAFIEINEVGTEAAAATAAVATFRSMPARQGPPKV-FHANRPFFYAIKD---NTHGLLFAG 371
            ...||||:|:||.|:||||:|:.|.|.||:    .|.:| |.|||||...|::   ||  ::|.|
  Rat   399 DAFHKAFLEVNEEGSEAAASTSVVITGRSL----NPSRVTFKANRPFLVLIREVALNT--IIFMG 457

  Fly   372  371
              Rat   458  457

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DbNP_610244.2 SERPIN 12..373 CDD:238101 119/383 (31%)
Serpinc1NP_001012027.1 antithrombin-III_like 80..459 CDD:239000 120/390 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.030

Return to query results.
Submit another query.