DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Db and Serpinb11

DIOPT Version :9

Sequence 1:NP_610244.2 Gene:Spn42Db / 35599 FlyBaseID:FBgn0033112 Length:388 Species:Drosophila melanogaster
Sequence 2:XP_006249694.2 Gene:Serpinb11 / 304689 RGDID:1306497 Length:522 Species:Rattus norvegicus


Alignment Length:383 Identity:115/383 - (30%)
Similarity:202/383 - (52%) Gaps:28/383 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 QFALCLHDHLCRASAGLNIIYSPLSIHISAAMLRMGTSEGSATAKEMDEGLRF----GGLEAQ-- 70
            :|.|.:...|..::.|.||.:|||:...:.:||.:|..  ..:|::|::.|.:    |.|:|:  
  Rat   144 EFCLDVFKELSSSNVGENIFFSPLTTFYALSMLLLGAR--GKSAEQMEKVLHYDNFSGFLKAKIK 206

  Fly    71 ---------QVAESFGVVLKSYEQCQVLKMANGLYVMKGLQVDEQFGHILEQKFRSKPMEIDF-- 124
                     ::...|..::....|...|.:||.:|..|.::..:|:....|:.:::|...:||  
  Rat   207 NSSECSQGGRMHPEFRALVSHINQQNSLSIANRIYGTKAIEFHKQYIRCCEKLYQAKLQTVDFEL 271

  Fly   125 GSEQAASIINKWVESQTNNLIKDIIGPRVLTKDSRLCLVNGIHFKGEWSISFNEKETREEDFFGS 189
            .:|:....||.|||::|:..|.::.....:...|.:.||:.|:|||:|...|.:.||.:..|..|
  Rat   272 SAEETRKSINAWVENKTHGKITNLFDKGTIDPSSVMVLVSAIYFKGQWQNKFQKTETVKAPFHIS 336

  Fly   190 -DRPTRVRMMHVCENFFFAVLPMFEATALRMNYSACNLAMIILLPDEKSNLTSLEKKLSDISLEV 253
             .:...|.||:....|..|.:...:...|.:.|:...|.||||||...:::..:||.|:...|..
  Rat   337 VGKSAVVDMMYQTGTFKLAFIKEPQMQVLELPYANNKLRMIILLPVGTASVNQIEKHLNAKMLRE 401

  Fly   254 VSSAMNLEK--VDVKIPSFTAEFQQELSQVLMLMGMNRIFS-GQAELGGMLQSEESLFVSQIVHK 315
            .:|..|:.:  |||.||.|:...:.:|:.:|..:||:.||: .:|:|.|| ..::.|::|::|||
  Rat   402 WTSPSNMVERVVDVHIPKFSLSVKYDLNTLLKSLGMSDIFNVAKADLSGM-SPDKGLYLSKVVHK 465

  Fly   316 AFIEINEVGTEAAAATAAVATFRSMPARQGPPKVFHANRPFFYAIKDNTHGLLFAGHF 373
            :::::||.||||||||....:.:.:|.    ...|.||.||.:.|.|..:.:||||.|
  Rat   466 SYVDVNEEGTEAAAATGETISVKRLPV----TVQFTANCPFLFFIWDEFYNILFAGKF 519

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DbNP_610244.2 SERPIN 12..373 CDD:238101 114/381 (30%)
Serpinb11XP_006249694.2 SERPIN 138..522 CDD:294093 115/383 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X28
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.930

Return to query results.
Submit another query.