DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Db and serpinh1b

DIOPT Version :9

Sequence 1:NP_610244.2 Gene:Spn42Db / 35599 FlyBaseID:FBgn0033112 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_001296752.1 Gene:serpinh1b / 30449 ZFINID:ZDB-GENE-990415-93 Length:405 Species:Danio rerio


Alignment Length:381 Identity:93/381 - (24%)
Similarity:169/381 - (44%) Gaps:38/381 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 ALCLHDHLCRASAGLNIIYSPLSIHISAAMLRMGTSEGSATAKEMDEGLRFGGLEAQQVAESFGV 78
            |..|:.::.:.....||:.||:.:..|..|:.||:.  |:||.::...|:...|:.:.:......
Zfish    38 AFNLYHNVAKEKGLENILISPVVVASSLGMVAMGSK--SSTASQVKSVLKADALKDEHLHTGLSE 100

  Fly    79 VLKSYEQCQ----VLKMANGLYVMKGLQVDEQFGHILEQKFRSKPMEIDFGSEQAA-SIINKWVE 138
            :|......|    ..|::|.||....:...|.|....::.:..:..:|:|..:::| :.||:|..
Zfish   101 LLTEVSDPQTRNVTWKISNRLYGPSSVSFAEDFVKNSKKHYNYEHSKINFRDKRSAINSINEWAA 165

  Fly   139 SQTNNLIKDIIGPRVLTKDSR----LCLVNGIHFKGEWSISFNEKETREEDFFGSDRPT-RVRMM 198
            ..|:..:.:|      |||.:    ..:||.:.||..|...|:.|......|..:...| .|.||
Zfish   166 KTTDGKLPEI------TKDVKNTDGAMIVNAMFFKPHWDEKFHHKMVDNRGFLVTRSHTVSVPMM 224

  Fly   199 HVCENFFFAVLPMFEATALRMNYSACNLA-----MIILLPDEKSNLTSLEKKLSDISLEVVSSAM 258
            |....:.|     :|.|..|....:..||     ||.::|.....|..||..|:...|:...|.:
Zfish   225 HRTGIYGF-----YEDTENRFLIVSMPLAHKKSSMIFIMPYHVEPLDRLENLLTRQQLDTWISKL 284

  Fly   259 NLEKVDVKIPSFTAEFQQELSQVLMLMGMNR-IFSGQAELGGMLQSEESLFVSQIVHKAFIEINE 322
            ....|.:.:|..:.|...:|.:.|..:|:.. :...:|:|.. :..::.|::|.:.|.:.:|.: 
Zfish   285 EERAVAISLPKVSMEVSHDLQKHLGELGLTEAVDKSKADLSN-ISGKKDLYLSNVFHASSLEWD- 347

  Fly   323 VGTEAAAATAAVATFRSMPARQGPPKVFHANRPFFYAIKDN-THGLLFAGHFITTK 377
              ||......::  |.|...|.  ||:|:|:.||.:.:||| |:.:||.|..:..|
Zfish   348 --TEGNPFDPSI--FGSEKMRN--PKLFYADHPFIFLVKDNKTNSILFIGRLVRPK 397

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DbNP_610244.2 SERPIN 12..373 CDD:238101 92/375 (25%)
serpinh1bNP_001296752.1 hsp47 28..393 CDD:239001 92/375 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.