DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Db and LOC299282

DIOPT Version :9

Sequence 1:NP_610244.2 Gene:Spn42Db / 35599 FlyBaseID:FBgn0033112 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_001376144.2 Gene:LOC299282 / 299282 RGDID:3745 Length:413 Species:Rattus norvegicus


Alignment Length:383 Identity:108/383 - (28%)
Similarity:192/383 - (50%) Gaps:39/383 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 FALCLHDHLCRASAGLNIIYSPLSIHISAAMLRMGTSEGSATAKEMDEGLRFGGLE--AQQVAES 75
            |||.|:..|...:...|:::|||||..:..:|.:|..:  :|.:|:.|||:|...|  .:::.:.
  Rat    52 FALSLYKKLALRNPDKNVVFSPLSISAALTILSLGAKD--STMEEILEGLKFNLTEITEEEIHQG 114

  Fly    76 FGVVLK--SYEQCQV-LKMANGLYVMKGLQVDEQFGHILEQKFRSKPMEIDFGS-EQAASIINKW 136
            ||.:|:  |..:.|| :...:.|::.|...:..:|.......::::....||.. .:|..:||.:
  Rat   115 FGHLLQRLSQPEDQVEINTGSALFIDKEQPILSEFQEKTRALYQAEAFIADFKQPNEAKKLINDY 179

  Fly   137 VESQTNNLIKDIIGPRVLTKDSRLCLVNGIHFKGEWSISFNEKETREEDFF-GSDRPTRVRMMHV 200
            |.:||...|.::...  |.:.:.:.|||.:.|||:|.:.||..:|.|.:|: ...|..:|.||.:
  Rat   180 VSNQTQGKIAELFSD--LEERTSMVLVNYLLFKGKWKVPFNPNDTFESEFYLDEKRSVKVPMMKI 242

  Fly   201 CENFFFAVLPM-----FEATALRMNYSACNLAMIILLPDEKSNLTSLEKKLSDISLE-----VVS 255
            .|    ...|.     ...:.|.:.|:. |.:.:.:|||: ..:..:|..|...:|:     ::.
  Rat   243 KE----VTTPYVRDEELSCSVLELKYTG-NASALFILPDQ-GKMQQVESSLQPETLKKWKDSLIP 301

  Fly   256 SAMNLEKVDVKIPSFTAEFQQELSQVLMLMGMNRIFSGQAELGGMLQSEESLFVSQIVHKAFIEI 320
            ..:|    |:::|.|:......|.:||..:|:.::||.||:| ..:...:.|:|||:||||.:::
  Rat   302 RIIN----DLRMPKFSISTDYSLKEVLPELGIKKVFSQQADL-SRITGTKDLYVSQVVHKAVLDV 361

  Fly   321 NEVGTEAAAATAAVATFRSMPARQGPPKVFHANRPFFYAIKD-NTHGLLFAGHFITTK 377
            :|.||||.|||......|    ||  |:..:.||||...|.| ::..:||.......|
  Rat   362 DETGTEATAATGVATVIR----RQ--PRTLNFNRPFMVVITDMDSQSILFVAKITNPK 413

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DbNP_610244.2 SERPIN 12..373 CDD:238101 107/377 (28%)
LOC299282NP_001376144.2 serpinA3_A1AC 36..413 CDD:381019 107/381 (28%)
RCL 365..389 11/29 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.