DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Db and Serpina9

DIOPT Version :9

Sequence 1:NP_610244.2 Gene:Spn42Db / 35599 FlyBaseID:FBgn0033112 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_001100224.1 Gene:Serpina9 / 299274 RGDID:1304789 Length:417 Species:Rattus norvegicus


Alignment Length:384 Identity:121/384 - (31%)
Similarity:183/384 - (47%) Gaps:30/384 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 QFALCLHDHLCRASAGLNIIYSPLSIHISAAMLRMGTSEGSATAKEMDEGLRFGGLEAQQVAE-- 74
            :||..|:..|.:.|.|.||::||:||..|.|||.:|..  |||..::   ||..|.....:||  
  Rat    51 KFAFLLYQRLAQKSPGQNILFSPVSISTSLAMLSLGAC--SATKTQI---LRSLGFNITHIAEHT 110

  Fly    75 ---SFGVVLKSYEQCQ---VLKMANGLYVMKGLQVDEQFGHILEQKFRSKPMEIDFGSEQAASI- 132
               .|..::.|..:|.   .|:|.:.|::.|.||:..:|...:::.:.:|....||.:...|.. 
  Rat   111 IHLGFEQLVHSLNECHKDLELRMGSVLFIRKELQLQVKFLDRVKKLYGTKVFSEDFSNAVTAQAQ 175

  Fly   133 INKWVESQTNNLIKDIIGPRVLTKDSRLCLVNGIHFKGEWSISFNEKETREEDFFGSDRPTRVR- 196
            ||.:||.:|...:.|:|  :.|...:.:.|||.|.||..|:..|:...|.:...|...:.|.|. 
  Rat   176 INSYVERETKGKVVDVI--QDLDSQTAMVLVNHIFFKANWTQPFSAANTNKSFPFLLSKGTTVHV 238

  Fly   197 -MMHVCENFFFAVLPMFEATALRMNYSACNLAMIILLPDEKSNLTSLEKKLSDISLEVVSSAMNL 260
             |||..|:|.|.|......:.|:|:|....:|..:|  ..|..:..||:.||...|...|.::..
  Rat   239 PMMHQTESFAFGVDRELGCSILQMDYRGDAVAFFVL--PGKGKMRQLERSLSPRRLRRWSRSLQK 301

  Fly   261 EKVDVKIPSFTAEFQQELSQVLMLMGMNRIFSGQAELGGMLQSEESLFVSQIVHKAFIEINEVGT 325
            ..:.|.||.|:......|..:|..||:...|:..|:..|:.:: ..|.||:..|||.::::|.||
  Rat   302 RWIKVFIPKFSISASYNLETILPEMGIRDAFNSNADFSGITKT-HFLQVSKAAHKAVLDVSEEGT 365

  Fly   326 EAAAATAAVATFRSMPARQGPPKVFHANRPFFYAIKD-NTHGLLFAGHFITTKVEQSEK 383
            ||||||......||   |..|......|.||...:.| ||..:||.|     |||...|
  Rat   366 EAAAATTTKLIVRS---RDTPSSTIAFNEPFLILLLDKNTESILFLG-----KVENPRK 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DbNP_610244.2 SERPIN 12..373 CDD:238101 117/372 (31%)
Serpina9NP_001100224.1 serpin 32..417 CDD:422956 121/384 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.110

Return to query results.
Submit another query.