DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Db and Serpinb6a

DIOPT Version :9

Sequence 1:NP_610244.2 Gene:Spn42Db / 35599 FlyBaseID:FBgn0033112 Length:388 Species:Drosophila melanogaster
Sequence 2:XP_006253933.1 Gene:Serpinb6a / 291085 RGDID:735108 Length:400 Species:Rattus norvegicus


Alignment Length:385 Identity:127/385 - (32%)
Similarity:201/385 - (52%) Gaps:25/385 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 EEFAQGLEQFALCLHDHLCRASAGLNIIYSPLSIHISAAMLRMGTSEGSATAKEMDEGLRF---- 64
            :...:|...|||.|...|...|:. ||..||:||..:..|:.||..  ..||.:|.:.|..    
  Rat    23 DHLQEGNGIFALKLLKTLSEDSSN-NIFLSPISISAALTMVFMGAK--GMTASQMVQTLSLDKCS 84

  Fly    65 --GGLEAQQVAESFGVVLKSYEQCQVLKMANGLYVMKGLQVDEQFGHILEQKFRSKPMEIDF--G 125
              ||.:..|..:|....:.......:||.||.|:..|...:...|.....:.:.::..|:||  .
  Rat    85 GNGGGDVHQGFQSLLAEVNKTGTQYLLKTANRLFGEKTCDILASFKDACRKFYEAEMEELDFKGD 149

  Fly   126 SEQAASIINKWVESQTNNLIKDIIGPRVLTKDSRLCLVNGIHFKGEWSISFNEKETREEDFFGS- 189
            :||:...||.||..:|.:.||:::.|.::..|:.|.|||.|:|||.|...||::.|||:.|..| 
  Rat   150 TEQSRQRINTWVAKKTEDKIKELLAPGIVDPDTVLVLVNAIYFKGNWDKQFNKEHTREKPFKVSK 214

  Fly   190 --DRPTRVRMMHVCENFFFAVLPMFEATALRMNYSACNLAMIILLPDEKSNLTSLEKKLS-DISL 251
              ::|  |:||.:...|....:.......|.:.|:...|.|||:||||...|.::||:|: :..:
  Rat   215 TEEKP--VQMMFMKSTFKMTYIGEIFTKILLLPYAGNELNMIIMLPDEHIELKTVEKELTYEKFI 277

  Fly   252 EVVS-SAMNLEKVDVKIPSFTAEFQQELSQVLMLMGMNRIF-SGQAELGGMLQSEESLFVSQIVH 314
            |... ..::.|:|:|.:|.|..|...::..||..:||...| .|:|:..| :.|::.||:|:::|
  Rat   278 EWTRLDMLDEEEVEVFLPRFKLEENYDMKVVLGKLGMTDAFMEGRADFSG-IASKQGLFLSKVIH 341

  Fly   315 KAFIEINEVGTEAAAATAAVATFRSMPARQGPPKVFHANRPFFYAIKD-NTHGLLFAGHF 373
            |||:|:||.||||.|||.:..|.|.:   :..|: |.|:.||.:.|:. .|.|:||.|.|
  Rat   342 KAFVEVNEEGTEAVAATGSTITMRCL---RFTPR-FLADHPFLFFIQHVKTKGILFCGRF 397

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DbNP_610244.2 SERPIN 12..373 CDD:238101 125/375 (33%)
Serpinb6aXP_006253933.1 SERPIN 25..400 CDD:294093 127/383 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBFJ
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X28
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.830

Return to query results.
Submit another query.