DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Db and Serpinb8

DIOPT Version :9

Sequence 1:NP_610244.2 Gene:Spn42Db / 35599 FlyBaseID:FBgn0033112 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_001099418.1 Gene:Serpinb8 / 288937 RGDID:1309833 Length:375 Species:Rattus norvegicus


Alignment Length:381 Identity:117/381 - (30%)
Similarity:182/381 - (47%) Gaps:21/381 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 EEFAQGLEQFALCLHDHLCRASAGLNIIYSPLSIHISAAMLRMGTSEGSATAKEMDEGLRFGGLE 68
            ::..:....||:.|...|.......|:.:.|:|:..:.||:.:|....:||......||...|  
  Rat     2 DDLCEANGSFAISLLKILGEEDKSRNLFFCPMSVSSALAMVYLGAKGNTATQMSQVLGLSGDG-- 64

  Fly    69 AQQVAESFGVVL----KSYEQCQVLKMANGLYVMKGLQVDEQFGHILEQKFRSKPMEIDF--GSE 127
              .|.:.|..:|    ||..| .:||.|..|:..:.......|....::.:::...|:.|  .:|
  Rat    65 --DVHQGFQTLLAEVNKSGTQ-YLLKSACRLFGEESCDFLSTFKESCQKFYQAGIEEMSFVKDTE 126

  Fly   128 QAASIINKWVESQTNNLIKDIIGPRVLTKDSRLCLVNGIHFKGEWSISFNEKETREEDF-FGSDR 191
            .....||.||..:|...|.:::.|..:...::|.|||.::|||:|...|:.|.||...| ...:.
  Rat   127 GCRKRINDWVLEKTEGKISEVLSPGTVCPLTKLVLVNAMYFKGKWKAQFDRKYTRGMPFKTNQEE 191

  Fly   192 PTRVRMMHVCENFFFAVLPMFEATALRMNYSACNLAMIILLPDEKSNLTSLEKKLSDISLEVVSS 256
            ...|:||.....|..|.:....|..|.:.|:...|:|::|||||.|:||.:||.|:...|...::
  Rat   192 KKTVQMMFKHAKFKMAHVDEVNAQVLALPYAEDELSMVVLLPDESSDLTVVEKALTYEKLRAWTN 256

  Fly   257 AMNL--EKVDVKIPSFTAEFQQELSQVLMLMGMNRIF-SGQAELGGMLQSEESLFVSQIVHKAFI 318
            ...|  .||.|..|....|...:|..||..:||...| ..:|:..|| .|::::.||::.||.|:
  Rat   257 PETLTESKVQVFFPRLKLEESYDLETVLQSLGMTDAFEETKADFSGM-TSKKNVPVSKVAHKCFV 320

  Fly   319 EINEVGTEAAAATAAVATFRSMPARQGPPKVFHANRPF-FYAIKDNTHGLLFAGHF 373
            |:||.||||||.||.:...||....   |: |.|:||| |:.....|..:||.|.|
  Rat   321 EVNEEGTEAAATTAVIRNTRSCRIE---PR-FCADRPFLFFIWHQKTSSILFCGRF 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DbNP_610244.2 SERPIN 12..373 CDD:238101 116/371 (31%)
Serpinb8NP_001099418.1 SERPIN 4..375 CDD:294093 117/379 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X28
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.930

Return to query results.
Submit another query.