DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Db and Serpinf2

DIOPT Version :9

Sequence 1:NP_610244.2 Gene:Spn42Db / 35599 FlyBaseID:FBgn0033112 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_001011892.1 Gene:Serpinf2 / 287527 RGDID:1306692 Length:491 Species:Rattus norvegicus


Alignment Length:376 Identity:94/376 - (25%)
Similarity:177/376 - (47%) Gaps:38/376 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 AQGLEQFALCLHDHLCRASAGLNIIYSPLSIHISAAMLRMGTSEGSATAKEMDEGLRFGGLEAQQ 71
            :|.:..|...|...:.:.|...|::.||||:.::.:.|.:|..  :.|.:.:...|.      ..
  Rat    83 SQAMMAFTTDLFSLVAQTSTSSNLVLSPLSVALALSHLALGAR--NQTLENLQRVLH------MN 139

  Fly    72 VAESFGVVLKSYEQCQ-----VLKMANGLYVMKGLQVDEQFGHILEQKFRSKPMEIDFGSEQAAS 131
            :......:|..:  ||     .:::|..:|:.||..:.:.|....|:.|.:||:::....|:...
  Rat   140 MGSCIPHLLSHF--CQNLNPGTIRLAARIYLQKGFPIKDDFLEQSEKLFGAKPVKLTGRQEEDLM 202

  Fly   132 IINKWVESQTNNLIKDIIGPRVLTKDSRLCLVNGIHFKGEWSISFNEKETREEDFFGSDRPT-RV 195
            .|||||:..|...|:|.:..  |..::.|.|:|.|||.|.|...|:...|:::.|...::.| .|
  Rat   203 NINKWVKEATEGKIEDFLSE--LPDNTVLLLLNAIHFHGFWRTKFDPSLTQKDSFHLDEQFTVPV 265

  Fly   196 RMMHVCE---NFFFAVLPMFEATALRMNYSACNLAMIILLPDEKSNLTSLEKKLSDISLEVV-SS 256
            .|||...   .:|....|..:........   |::.::::|....  .::.:.|::::.:.: ..
  Rat   266 AMMHAQSYPLRWFLLEQPEIQVAHFPFQN---NMSFVVIMPTYFG--WNVSEVLANLTWDTLYQP 325

  Fly   257 AMNLEKVDVKIPSFTAEFQQELSQVLMLMGMNRIFSGQAELGGMLQSEESLFVSQIVHKAFIEIN 321
            :|..:...|::|....|...:|...|..:|:..:|. ..:|.|:  |::||.||.:.|::.:|::
  Rat   326 SMREKPTKVRLPKLHLEQHLDLVATLSKLGLQDLFQ-SPDLRGI--SDQSLVVSSVQHQSTMELS 387

  Fly   322 EVGTEAAAATAAVATFRSMPARQGPPKVFHANRPFFYAIKDNTHGL-LFAG 371
            |.|.||||||:...|..|:.:       |..||||.:.|.:.|.|: ||.|
  Rat   388 EAGVEAAAATSTAMTRMSLSS-------FFLNRPFIFFIMEETIGIPLFVG 431

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DbNP_610244.2 SERPIN 12..373 CDD:238101 93/371 (25%)
Serpinf2NP_001011892.1 alpha2AP 82..433 CDD:239008 94/376 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.