DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Db and Serpinf1

DIOPT Version :9

Sequence 1:NP_610244.2 Gene:Spn42Db / 35599 FlyBaseID:FBgn0033112 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_808788.1 Gene:Serpinf1 / 287526 RGDID:631369 Length:418 Species:Rattus norvegicus


Alignment Length:363 Identity:82/363 - (22%)
Similarity:157/363 - (43%) Gaps:43/363 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 NIIYSPLSIHISAAMLRMGTSEGSATAKEMDEGLRFGGLEAQQVAESFGVVLKSYEQCQV-LKMA 92
            ||:.||||:..:.:.|.:|..:  .|...:...|.:..:....:..::..:|.|....:. .|.|
  Rat    77 NILLSPLSVATALSALSLGAEQ--RTESVIHRALYYDLINNPDIHSTYKELLASVTAPEKNFKSA 139

  Fly    93 NGLYVMKGLQVDEQFGHILEQKFRSKPMEIDFGSEQAASIINKWVESQTNNLIKDIIGPRVLTKD 157
            :.:...:.|:|...|...||:.:.::|..:..........||.||::|....|..  ..|.:...
  Rat   140 SRIVFERKLRVKSSFVAPLEKSYGTRPRILTGNPRIDLQEINNWVQAQMKGKIAR--STREMPSA 202

  Fly   158 SRLCLVNGIHFKGEWSISFNEKETREEDF-FGSDRPTRVRMMHVCE-----------NFFFAVLP 210
            ..:.|:...:|||:|:..|:.::|..:|| ...||..||.||...:           |...|.||
  Rat   203 LSILLLGVAYFKGQWATKFDSRKTTLQDFHLDEDRTVRVPMMSDPKAILRYGLDSDLNCKIAQLP 267

  Fly   211 MFEATALRMNYSACNLAMIILLP-DEKSNLTSLEKKLSDISLEVVSSAMNLEKVDVKIPSFTAEF 274
            :           ..::::|..|| ....|||.:|:.|:...:..:...:...:..:.:|.....:
  Rat   268 L-----------TGSMSIIFFLPLTVTQNLTMIEESLTSEFVHDIDRELKTIQAVLTVPKLKLSY 321

  Fly   275 QQELSQVLMLMGMNRIFSGQ--AELGGMLQSEESLFVSQIVHKAFIEINEVGTEAAAATAAVATF 337
            :.:::..|..|.:..:|...  :::.|     :.:.::|:.|:|..|.||.|    |.|::....
  Rat   322 EGDVTNSLQDMKLQSLFESPDFSKITG-----KPVKLTQVEHRAAFEWNEEG----AGTSSNPDL 377

  Fly   338 RSMPARQGPPKVFHANRPFFYAIKD-NTHGLLFAGHFI 374
            :  |.|...|..:|.||||.:.::| :|..|||.|..:
  Rat   378 Q--PVRLTFPLDYHLNRPFIFVLRDTDTGALLFIGRIL 413

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DbNP_610244.2 SERPIN 12..373 CDD:238101 82/360 (23%)
Serpinf1NP_808788.1 PEDF 40..415 CDD:239007 82/363 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.