DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Db and Serpina3b

DIOPT Version :9

Sequence 1:NP_610244.2 Gene:Spn42Db / 35599 FlyBaseID:FBgn0033112 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_766612.1 Gene:Serpina3b / 271047 MGIID:2182835 Length:420 Species:Mus musculus


Alignment Length:387 Identity:101/387 - (26%)
Similarity:185/387 - (47%) Gaps:36/387 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 FALCLHDHLCRASAGLNIIYSPLSIHISAAMLRMGTSEGSATAKEMDEGLRFGGLEAQQ--VAES 75
            ||...:..|...:...||.:||..|..:...|.:| ::|: |.:|:.|.|:|...|..:  :.:.
Mouse    54 FAFSFYKELALKNPHKNIAFSPFGIATALNSLTLG-AKGN-TLEEILEVLKFNLTETSEADIHQG 116

  Fly    76 FGVVLK--SYEQCQV-LKMANGLYVMKGLQVDEQFGHILEQKFRSKPMEIDFGS-EQAASIINKW 136
            |..:|:  |:...|| ::..|.|:|.|.||:..:|.......:.::....:|.. .:|..:||.:
Mouse   117 FKHLLQRLSHPGDQVQIRTGNALFVEKHLQILAEFKEKARALYHTEVFTANFQQPHEAMKLINSY 181

  Fly   137 VESQTNNLIKDIIGPRVLTKDSRLCLVNGIHFKGEWSISFNEKETREEDFFGS---DRPTRVRM- 197
            :.:||...||:::..  :..::.:.:||.:.||.||.:.||..:|    |.|.   ||...|:: 
Mouse   182 MSNQTQGKIKELVSD--MDGNTSMVIVNDLFFKAEWMVPFNSDDT----FMGKFIVDRSRHVKVP 240

  Fly   198 MHVCENFFFAVLPMF-----EATALRMNYSACNLAMIILLPDEKSNLTSLEKKLSDISLEVVSSA 257
            |...:|.   ..|.|     :.|.:.:||.....||.| |||: ..:..:|..|...:|:....:
Mouse   241 MMKTKNL---RTPYFRDEELKCTVVELNYKGNGKAMFI-LPDQ-GKMQQVEASLQPGTLKKWRKS 300

  Fly   258 MNLEKV-DVKIPSFTAEFQQELSQVLMLMGMNRIFSGQAELGGMLQSEESLFVSQIVHKAFIEIN 321
            :...|: ::.:|.|:......|..:|..:|:..:||.||:|.| :...:::.||:::|...:::.
Mouse   301 LRPRKIKELHLPKFSLSQHYNLEDILPELGIRELFSTQADLSG-ITGVKNITVSEMIHSTELDMT 364

  Fly   322 EVGTEAAAATAAVATFRSMPARQGPPKVFHANRPFFYAIKDNTHGLLFAGHFITTKVEQSEK 383
            |.|||..|.|  :..:..|.|:..|..|...:: |.|.:.|  .|.|:. |.:...:..|||
Mouse   365 EKGTEGDAIT--IVGYNFMSAKLKPVFVKFEDQ-FLYIVLD--QGDLWI-HVMGKVINPSEK 420

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DbNP_610244.2 SERPIN 12..373 CDD:238101 97/375 (26%)
Serpina3bNP_766612.1 SERPIN 51..414 CDD:294093 98/379 (26%)
RCL 367..392 9/26 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.